BLASTX nr result
ID: Chrysanthemum22_contig00015657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015657 (627 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI01648.1| hypothetical protein Ccrd_020075 [Cynara carduncu... 73 4e-13 gb|KVI08929.1| hypothetical protein Ccrd_012693 [Cynara carduncu... 68 2e-10 ref|XP_023751858.1| uncharacterized protein LOC111900218 [Lactuc... 57 2e-06 >gb|KVI01648.1| hypothetical protein Ccrd_020075 [Cynara cardunculus var. scolymus] Length = 119 Score = 73.2 bits (178), Expect = 4e-13 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = -3 Query: 625 VRRNAAERVESGNEHGHGGETPSCIKVKHRRMSKKKAMEKQKAYPTDLSHDITHPGDKS* 446 VRRN AE ESGN+H GETPS +VKHRRMSKKKA +K K TDL H+ + P DK Sbjct: 54 VRRNVAEGPESGNDHNFRGETPSTXEVKHRRMSKKKARDKTKI--TDLCHEASSPXDKIK 111 Query: 445 AFSRES 428 FS S Sbjct: 112 VFSESS 117 >gb|KVI08929.1| hypothetical protein Ccrd_012693 [Cynara cardunculus var. scolymus] Length = 205 Score = 68.2 bits (165), Expect = 2e-10 Identities = 39/69 (56%), Positives = 42/69 (60%), Gaps = 11/69 (15%) Frame = -3 Query: 625 VRRNAAERVESGNEHGH-----------GGETPSCIKVKHRRMSKKKAMEKQKAYPTDLS 479 VRRN AE ESGN H GGETPS IKVKHRRMSKKKA +K K TDL Sbjct: 131 VRRNVAEGPESGNNHNFSKTLKPCSASSGGETPSTIKVKHRRMSKKKARDKTKT--TDLC 188 Query: 478 HDITHPGDK 452 H+ + P DK Sbjct: 189 HEASSPADK 197 >ref|XP_023751858.1| uncharacterized protein LOC111900218 [Lactuca sativa] ref|XP_023751859.1| uncharacterized protein LOC111900218 [Lactuca sativa] Length = 181 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/57 (56%), Positives = 35/57 (61%) Frame = -3 Query: 625 VRRNAAERVESGNEHGHGGETPSCIKVKHRRMSKKKAMEKQKAYPTDLSHDITHPGD 455 VRRN ER ESGN + S IKVKHRRMSKKKA + K D SH+ T PGD Sbjct: 128 VRRNVTERSESGNNRE---DAVSSIKVKHRRMSKKKARGQPKDTSIDPSHETTSPGD 181