BLASTX nr result
ID: Chrysanthemum22_contig00015454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015454 (781 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE86339.1| gdp-l-galactose phosphorylase 1 [Quercus suber] 53 8e-06 >gb|POE86339.1| gdp-l-galactose phosphorylase 1 [Quercus suber] Length = 77 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -3 Query: 362 IDSEGFSVTLYMAAETGS*HFCFGYNSLAILATINHLEFQHVWWSANAGDW 210 ID + F + L+MAAE G+ +F GYNSL ATINHL FQ + A+ +W Sbjct: 15 IDRDSFLLALHMAAEAGNPYFRLGYNSLGAFATINHLHFQAYYLHADYREW 65