BLASTX nr result
ID: Chrysanthemum22_contig00015421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015421 (1331 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY68997.1| hypothetical protein LSAT_9X88720 [Lactuca sativa] 72 2e-09 ref|XP_023740025.1| E3 ubiquitin-protein ligase UPL1-like [Lactu... 72 2e-09 ref|XP_022001555.1| E3 ubiquitin-protein ligase UPL1-like [Helia... 70 5e-09 ref|XP_018507976.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 7e-09 ref|XP_018507975.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 7e-09 ref|XP_009379457.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 7e-09 ref|XP_009379456.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 70 7e-09 gb|KVI02344.1| Armadillo [Cynara cardunculus var. scolymus] 70 9e-09 ref|XP_022028348.1| E3 ubiquitin-protein ligase UPL1-like [Helia... 70 9e-09 gb|OAY28337.1| hypothetical protein MANES_15G059000, partial [Ma... 69 2e-08 gb|EEF39625.1| E3 ubiquitin protein ligase upl2, putative [Ricin... 69 2e-08 ref|XP_015577012.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 ... 69 2e-08 ref|XP_021595001.1| E3 ubiquitin-protein ligase UPL1-like isofor... 69 2e-08 ref|XP_021641769.1| E3 ubiquitin-protein ligase UPL1-like isofor... 69 2e-08 ref|XP_021641768.1| E3 ubiquitin-protein ligase UPL1-like isofor... 69 2e-08 ref|XP_021594998.1| E3 ubiquitin-protein ligase UPL1-like isofor... 69 2e-08 ref|XP_012071061.1| E3 ubiquitin-protein ligase UPL1 [Jatropha c... 69 2e-08 ref|XP_021689903.1| E3 ubiquitin-protein ligase UPL1-like [Hevea... 69 2e-08 ref|XP_020421168.1| E3 ubiquitin-protein ligase UPL1 isoform X3 ... 68 4e-08 ref|XP_020421167.1| E3 ubiquitin-protein ligase UPL1 isoform X2 ... 68 4e-08 >gb|PLY68997.1| hypothetical protein LSAT_9X88720 [Lactuca sativa] Length = 3692 Score = 72.0 bits (175), Expect = 2e-09 Identities = 42/66 (63%), Positives = 44/66 (66%), Gaps = 13/66 (19%) Frame = +2 Query: 1172 APPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLR 1312 AP PV+ + E L A P QRVAHQAEGQPVDMDNASIIATFPADLR Sbjct: 2603 APAPVTAEDIDPEFLAALPPDIQAEVLAQQRAQRVAHQAEGQPVDMDNASIIATFPADLR 2662 Query: 1313 EEVLLT 1330 EEVLLT Sbjct: 2663 EEVLLT 2668 >ref|XP_023740025.1| E3 ubiquitin-protein ligase UPL1-like [Lactuca sativa] ref|XP_023740026.1| E3 ubiquitin-protein ligase UPL1-like [Lactuca sativa] Length = 3695 Score = 72.0 bits (175), Expect = 2e-09 Identities = 42/66 (63%), Positives = 44/66 (66%), Gaps = 13/66 (19%) Frame = +2 Query: 1172 APPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLR 1312 AP PV+ + E L A P QRVAHQAEGQPVDMDNASIIATFPADLR Sbjct: 2606 APAPVTAEDIDPEFLAALPPDIQAEVLAQQRAQRVAHQAEGQPVDMDNASIIATFPADLR 2665 Query: 1313 EEVLLT 1330 EEVLLT Sbjct: 2666 EEVLLT 2671 >ref|XP_022001555.1| E3 ubiquitin-protein ligase UPL1-like [Helianthus annuus] gb|OTG02021.1| putative HECT domain-containing protein [Helianthus annuus] Length = 3594 Score = 70.5 bits (171), Expect = 5e-09 Identities = 41/66 (62%), Positives = 43/66 (65%), Gaps = 13/66 (19%) Frame = +2 Query: 1172 APPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLR 1312 AP P + + E L A P QRVAHQAEGQPVDMDNASIIATFPADLR Sbjct: 2531 APTPATAEEIDPEFLAALPPDIQAEVLAQQRAQRVAHQAEGQPVDMDNASIIATFPADLR 2590 Query: 1313 EEVLLT 1330 EEVLLT Sbjct: 2591 EEVLLT 2596 >ref|XP_018507976.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X4 [Pyrus x bretschneideri] Length = 3751 Score = 70.1 bits (170), Expect = 7e-09 Identities = 37/52 (71%), Positives = 40/52 (76%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPPQRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 PP + D + + QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2705 PPDIQDEVLAQQRA----QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2752 >ref|XP_018507975.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X3 [Pyrus x bretschneideri] Length = 3767 Score = 70.1 bits (170), Expect = 7e-09 Identities = 37/52 (71%), Positives = 40/52 (76%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPPQRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 PP + D + + QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2721 PPDIQDEVLAQQRA----QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2768 >ref|XP_009379457.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X2 [Pyrus x bretschneideri] Length = 3786 Score = 70.1 bits (170), Expect = 7e-09 Identities = 37/52 (71%), Positives = 40/52 (76%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPPQRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 PP + D + + QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2740 PPDIQDEVLAQQRA----QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2787 >ref|XP_009379456.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like isoform X1 [Pyrus x bretschneideri] Length = 3787 Score = 70.1 bits (170), Expect = 7e-09 Identities = 37/52 (71%), Positives = 40/52 (76%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPPQRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 PP + D + + QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2741 PPDIQDEVLAQQRA----QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2788 >gb|KVI02344.1| Armadillo [Cynara cardunculus var. scolymus] Length = 3504 Score = 69.7 bits (169), Expect = 9e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 1229 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2476 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2509 >ref|XP_022028348.1| E3 ubiquitin-protein ligase UPL1-like [Helianthus annuus] ref|XP_022028349.1| E3 ubiquitin-protein ligase UPL1-like [Helianthus annuus] gb|OTG31294.1| putative ubiquitin-protein ligase 1 [Helianthus annuus] Length = 3532 Score = 69.7 bits (169), Expect = 9e-09 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +2 Query: 1229 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 1330 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT Sbjct: 2509 QRVAHQAEGQPVDMDNASIIATFPADLREEVLLT 2542 >gb|OAY28337.1| hypothetical protein MANES_15G059000, partial [Manihot esculenta] gb|OAY28338.1| hypothetical protein MANES_15G059000, partial [Manihot esculenta] Length = 3648 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2583 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2640 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2641 EVLLT 2645 >gb|EEF39625.1| E3 ubiquitin protein ligase upl2, putative [Ricinus communis] Length = 3691 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2629 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2686 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2687 EVLLT 2691 >ref|XP_015577012.1| PREDICTED: E3 ubiquitin-protein ligase UPL1 [Ricinus communis] Length = 3698 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2636 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2693 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2694 EVLLT 2698 >ref|XP_021595001.1| E3 ubiquitin-protein ligase UPL1-like isoform X2 [Manihot esculenta] Length = 3728 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2663 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2720 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2721 EVLLT 2725 >ref|XP_021641769.1| E3 ubiquitin-protein ligase UPL1-like isoform X2 [Hevea brasiliensis] Length = 3757 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2694 PPPVDD--IDPEFLAALPPDIQAEVLAQQRVQRIAQQAEGQPVDMDNASIIATFPADLRE 2751 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2752 EVLLT 2756 >ref|XP_021641768.1| E3 ubiquitin-protein ligase UPL1-like isoform X1 [Hevea brasiliensis] Length = 3758 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2695 PPPVDD--IDPEFLAALPPDIQAEVLAQQRVQRIAQQAEGQPVDMDNASIIATFPADLRE 2752 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2753 EVLLT 2757 >ref|XP_021594998.1| E3 ubiquitin-protein ligase UPL1-like isoform X1 [Manihot esculenta] ref|XP_021594999.1| E3 ubiquitin-protein ligase UPL1-like isoform X1 [Manihot esculenta] ref|XP_021595000.1| E3 ubiquitin-protein ligase UPL1-like isoform X1 [Manihot esculenta] Length = 3760 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2695 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2752 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2753 EVLLT 2757 >ref|XP_012071061.1| E3 ubiquitin-protein ligase UPL1 [Jatropha curcas] Length = 3762 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2698 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2755 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2756 EVLLT 2760 >ref|XP_021689903.1| E3 ubiquitin-protein ligase UPL1-like [Hevea brasiliensis] Length = 3764 Score = 68.9 bits (167), Expect = 2e-08 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 13/65 (20%) Frame = +2 Query: 1175 PPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLRE 1315 PPPV D + E L A P QR+A QAEGQPVDMDNASIIATFPADLRE Sbjct: 2699 PPPVDD--IDPEFLAALPPDIQAEVLAQQRAQRIAQQAEGQPVDMDNASIIATFPADLRE 2756 Query: 1316 EVLLT 1330 EVLLT Sbjct: 2757 EVLLT 2761 >ref|XP_020421168.1| E3 ubiquitin-protein ligase UPL1 isoform X3 [Prunus persica] gb|ONH99313.1| hypothetical protein PRUPE_6G024400 [Prunus persica] Length = 3730 Score = 67.8 bits (164), Expect = 4e-08 Identities = 42/66 (63%), Positives = 43/66 (65%), Gaps = 13/66 (19%) Frame = +2 Query: 1172 APPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLR 1312 APP V D + E L A P QRVA QAEGQPVDMDNASIIATFPADLR Sbjct: 2660 APPSVDD--IDPEFLAALPPDIQAEVLAQQRAQRVAQQAEGQPVDMDNASIIATFPADLR 2717 Query: 1313 EEVLLT 1330 EEVLLT Sbjct: 2718 EEVLLT 2723 >ref|XP_020421167.1| E3 ubiquitin-protein ligase UPL1 isoform X2 [Prunus persica] Length = 3765 Score = 67.8 bits (164), Expect = 4e-08 Identities = 42/66 (63%), Positives = 43/66 (65%), Gaps = 13/66 (19%) Frame = +2 Query: 1172 APPPVSDFSVGLESLRAPP-------------QRVAHQAEGQPVDMDNASIIATFPADLR 1312 APP V D + E L A P QRVA QAEGQPVDMDNASIIATFPADLR Sbjct: 2695 APPSVDD--IDPEFLAALPPDIQAEVLAQQRAQRVAQQAEGQPVDMDNASIIATFPADLR 2752 Query: 1313 EEVLLT 1330 EEVLLT Sbjct: 2753 EEVLLT 2758