BLASTX nr result
ID: Chrysanthemum22_contig00015280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015280 (856 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021987873.1| protein TIC 56, chloroplastic [Helianthus an... 60 3e-14 ref|XP_023758286.1| protein TIC 56, chloroplastic [Lactuca sativ... 60 1e-13 gb|PIN26341.1| hypothetical protein CDL12_00927 [Handroanthus im... 55 9e-13 gb|PIN22988.1| hypothetical protein CDL12_04298 [Handroanthus im... 55 9e-13 ref|XP_019227467.1| PREDICTED: protein TIC 56, chloroplastic [Ni... 55 9e-13 ref|XP_009804815.1| PREDICTED: uncharacterized protein LOC104249... 55 9e-13 ref|XP_017253796.1| PREDICTED: protein TIC 56, chloroplastic [Da... 56 9e-13 ref|XP_007134661.1| hypothetical protein PHAVU_010G065700g [Phas... 58 1e-12 ref|XP_015897454.1| PREDICTED: protein TIC 56, chloroplastic [Zi... 54 1e-12 gb|KZM95432.1| hypothetical protein DCAR_018674 [Daucus carota s... 55 2e-12 ref|XP_016184001.1| protein TIC 56, chloroplastic [Arachis ipaen... 56 3e-12 ref|XP_015950503.1| protein TIC 56, chloroplastic [Arachis duran... 56 3e-12 gb|PHT35709.1| Protein TIC 56, chloroplastic [Capsicum baccatum] 56 3e-12 ref|XP_014514459.1| protein TIC 56, chloroplastic [Vigna radiata... 57 4e-12 ref|XP_017442610.1| PREDICTED: protein TIC 56, chloroplastic [Vi... 57 4e-12 ref|XP_015088434.1| PREDICTED: protein TIC 56, chloroplastic [So... 53 4e-12 ref|XP_006359553.1| PREDICTED: protein TIC 56, chloroplastic [So... 53 4e-12 ref|XP_004246347.1| PREDICTED: protein TIC 56, chloroplastic [So... 53 4e-12 ref|XP_016551155.1| PREDICTED: protein TIC 56, chloroplastic [Ca... 55 5e-12 gb|PHT32444.1| Protein TIC 56, chloroplastic [Capsicum baccatum] 55 5e-12 >ref|XP_021987873.1| protein TIC 56, chloroplastic [Helianthus annuus] gb|OTG10397.1| hypothetical protein HannXRQ_Chr10g0287121 [Helianthus annuus] Length = 524 Score = 60.5 bits (145), Expect(2) = 3e-14 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILEQ HMPNKYIPK RKQL KAI L P EV Sbjct: 369 ALFLWASGSELTSILEQDHMPNKYIPKDMRKQLQKAIPGLRPWEV 413 Score = 47.0 bits (110), Expect(2) = 3e-14 Identities = 20/25 (80%), Positives = 23/25 (92%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q+EAYES +RD+AV EANDGIWPGV Sbjct: 339 QDEAYESKKRDLAVLEANDGIWPGV 363 >ref|XP_023758286.1| protein TIC 56, chloroplastic [Lactuca sativa] gb|PLY89602.1| hypothetical protein LSAT_9X37301 [Lactuca sativa] Length = 528 Score = 60.5 bits (145), Expect(2) = 1e-13 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILEQ HMPNKYIPK RKQL KAI L P EV Sbjct: 370 ALFLWASGSELTSILEQDHMPNKYIPKDMRKQLQKAIPGLRPWEV 414 Score = 45.1 bits (105), Expect(2) = 1e-13 Identities = 19/25 (76%), Positives = 23/25 (92%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q+EAYES +RD+AV EAN+GIWPGV Sbjct: 340 QDEAYESKKRDLAVLEANNGIWPGV 364 >gb|PIN26341.1| hypothetical protein CDL12_00927 [Handroanthus impetiginosus] Length = 521 Score = 55.1 bits (131), Expect(2) = 9e-13 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE+ HMPNKYIPK R QL K I L P EV Sbjct: 361 ALFLWASGSELTSILEEDHMPNKYIPKDIRLQLAKIIPGLRPWEV 405 Score = 47.4 bits (111), Expect(2) = 9e-13 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 331 QEEAYESKRRDLAVLEANDGVWPGV 355 >gb|PIN22988.1| hypothetical protein CDL12_04298 [Handroanthus impetiginosus] Length = 521 Score = 55.1 bits (131), Expect(2) = 9e-13 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE+ HMPNKYIPK R QL K I L P EV Sbjct: 361 ALFLWASGSELTSILEEDHMPNKYIPKDIRLQLAKIIPGLRPWEV 405 Score = 47.4 bits (111), Expect(2) = 9e-13 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 331 QEEAYESKRRDLAVLEANDGVWPGV 355 >ref|XP_019227467.1| PREDICTED: protein TIC 56, chloroplastic [Nicotiana attenuata] gb|OIT31367.1| protein tic 56, chloroplastic [Nicotiana attenuata] Length = 510 Score = 55.1 bits (131), Expect(2) = 9e-13 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 360 ALFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 404 Score = 47.4 bits (111), Expect(2) = 9e-13 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 330 QEEAYESKRRDLAVLEANDGVWPGV 354 >ref|XP_009804815.1| PREDICTED: uncharacterized protein LOC104249972 [Nicotiana sylvestris] ref|XP_016506593.1| PREDICTED: protein TIC 56, chloroplastic-like [Nicotiana tabacum] Length = 510 Score = 55.1 bits (131), Expect(2) = 9e-13 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 360 ALFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 404 Score = 47.4 bits (111), Expect(2) = 9e-13 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 330 QEEAYESKRRDLAVLEANDGVWPGV 354 >ref|XP_017253796.1| PREDICTED: protein TIC 56, chloroplastic [Daucus carota subsp. sativus] Length = 496 Score = 56.2 bits (134), Expect(2) = 9e-13 Identities = 31/45 (68%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK R QL KAI L P EV Sbjct: 359 ALFLWASGSELTSILENDHMPNKYIPKDLRLQLAKAIPGLRPWEV 403 Score = 46.2 bits (108), Expect(2) = 9e-13 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q+EAYES RRD+ V EANDG+WPGV Sbjct: 329 QDEAYESKRRDLTVLEANDGVWPGV 353 >ref|XP_007134661.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris] ref|XP_007134662.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris] gb|ESW06655.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris] gb|ESW06656.1| hypothetical protein PHAVU_010G065700g [Phaseolus vulgaris] Length = 529 Score = 57.8 bits (138), Expect(2) = 1e-12 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SE+T+ILEQ HMPNKYIPKH RK+L + I L P EV Sbjct: 373 ALFLWASGSEMTTILEQDHMPNKYIPKHVRKRLAEIIPGLRPWEV 417 Score = 43.9 bits (102), Expect(2) = 1e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EA ES RRD+AV EANDG+WPGV Sbjct: 343 QEEAVESKRRDLAVLEANDGLWPGV 367 >ref|XP_015897454.1| PREDICTED: protein TIC 56, chloroplastic [Ziziphus jujuba] ref|XP_015897455.1| PREDICTED: protein TIC 56, chloroplastic [Ziziphus jujuba] ref|XP_015897456.1| PREDICTED: protein TIC 56, chloroplastic [Ziziphus jujuba] Length = 518 Score = 54.3 bits (129), Expect(2) = 1e-12 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 133 LFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 LF A+ SELT+ILEQ HMPNKYIPK R+QL K I L P EV Sbjct: 371 LFLWASGSELTTILEQDHMPNKYIPKDLRRQLNKIIPGLRPWEV 414 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 4/33 (12%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV----HCFF 124 Q EA ES RRD+AV EANDG+WPGV HC F Sbjct: 340 QEEAVESKRRDLAVLEANDGVWPGVRIPSHCLF 372 >gb|KZM95432.1| hypothetical protein DCAR_018674 [Daucus carota subsp. sativus] Length = 665 Score = 54.7 bits (130), Expect(2) = 2e-12 Identities = 30/44 (68%), Positives = 31/44 (70%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAE 5 ALF A+ SELTSILE HMPNKYIPK R QL KAI L P E Sbjct: 359 ALFLWASGSELTSILENDHMPNKYIPKDLRLQLAKAIPGLRPWE 402 Score = 46.2 bits (108), Expect(2) = 2e-12 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q+EAYES RRD+ V EANDG+WPGV Sbjct: 329 QDEAYESKRRDLTVLEANDGVWPGV 353 >ref|XP_016184001.1| protein TIC 56, chloroplastic [Arachis ipaensis] Length = 506 Score = 56.2 bits (134), Expect(2) = 3e-12 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELT+ILE+ HMPNKYIP+H R QL K I L P EV Sbjct: 365 ALFLWASGSELTTILEEDHMPNKYIPRHLRLQLAKIIPGLRPWEV 409 Score = 44.3 bits (103), Expect(2) = 3e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EA ES RRD+AV EANDG+WPGV Sbjct: 335 QEEAIESKRRDLAVLEANDGVWPGV 359 >ref|XP_015950503.1| protein TIC 56, chloroplastic [Arachis duranensis] Length = 506 Score = 56.2 bits (134), Expect(2) = 3e-12 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELT+ILE+ HMPNKYIP+H R QL K I L P EV Sbjct: 365 ALFLWASGSELTTILEEDHMPNKYIPRHLRLQLAKIIPGLRPWEV 409 Score = 44.3 bits (103), Expect(2) = 3e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EA ES RRD+AV EANDG+WPGV Sbjct: 335 QEEAIESKRRDLAVLEANDGVWPGV 359 >gb|PHT35709.1| Protein TIC 56, chloroplastic [Capsicum baccatum] Length = 430 Score = 55.8 bits (133), Expect(2) = 3e-12 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK+ RK+L K I L P EV Sbjct: 274 ALFLWASGSELTSILEADHMPNKYIPKNLRKELEKVIPGLRPWEV 318 Score = 44.7 bits (104), Expect(2) = 3e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EAN G+WPGV Sbjct: 244 QEEAYESKRRDLAVLEANGGVWPGV 268 >ref|XP_014514459.1| protein TIC 56, chloroplastic [Vigna radiata var. radiata] ref|XP_014514461.1| protein TIC 56, chloroplastic [Vigna radiata var. radiata] Length = 528 Score = 57.4 bits (137), Expect(2) = 4e-12 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELT+ILEQ HMPNKYIP+H RK+L + I L P EV Sbjct: 373 ALFLWASGSELTTILEQDHMPNKYIPRHVRKKLAELIPGLRPWEV 417 Score = 42.7 bits (99), Expect(2) = 4e-12 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EA +S RRD+AV EANDG+WPGV Sbjct: 343 QEEAIQSKRRDLAVLEANDGLWPGV 367 >ref|XP_017442610.1| PREDICTED: protein TIC 56, chloroplastic [Vigna angularis] ref|XP_017442611.1| PREDICTED: protein TIC 56, chloroplastic [Vigna angularis] dbj|BAT97460.1| hypothetical protein VIGAN_09090900 [Vigna angularis var. angularis] Length = 526 Score = 57.4 bits (137), Expect(2) = 4e-12 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELT+ILEQ HMPNKYIP+H RK+L + I L P EV Sbjct: 371 ALFLWASGSELTTILEQDHMPNKYIPRHVRKKLAELIPGLRPWEV 415 Score = 42.7 bits (99), Expect(2) = 4e-12 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EA +S RRD+AV EANDG+WPGV Sbjct: 341 QEEAIQSKRRDLAVLEANDGLWPGV 365 >ref|XP_015088434.1| PREDICTED: protein TIC 56, chloroplastic [Solanum pennellii] Length = 509 Score = 52.8 bits (125), Expect(2) = 4e-12 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 133 LFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 +F A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 360 MFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 403 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 329 QEEAYESRRRDLAVLEANDGVWPGV 353 >ref|XP_006359553.1| PREDICTED: protein TIC 56, chloroplastic [Solanum tuberosum] Length = 509 Score = 52.8 bits (125), Expect(2) = 4e-12 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 133 LFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 +F A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 360 MFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 403 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 329 QEEAYESRRRDLAVLEANDGVWPGV 353 >ref|XP_004246347.1| PREDICTED: protein TIC 56, chloroplastic [Solanum lycopersicum] Length = 509 Score = 52.8 bits (125), Expect(2) = 4e-12 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 133 LFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 +F A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 360 MFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 403 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EANDG+WPGV Sbjct: 329 QEEAYESRRRDLAVLEANDGVWPGV 353 >ref|XP_016551155.1| PREDICTED: protein TIC 56, chloroplastic [Capsicum annuum] gb|PHT66419.1| Protein TIC 56, chloroplastic [Capsicum annuum] Length = 512 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 362 ALFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 406 Score = 44.7 bits (104), Expect(2) = 5e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EAN G+WPGV Sbjct: 332 QEEAYESKRRDLAVLEANGGVWPGV 356 >gb|PHT32444.1| Protein TIC 56, chloroplastic [Capsicum baccatum] Length = 445 Score = 55.1 bits (131), Expect(2) = 5e-12 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -1 Query: 136 ALFF*ATCSELTSILEQQHMPNKYIPKHTRKQLLKAILELTPAEV 2 ALF A+ SELTSILE HMPNKYIPK RK+L K I L P EV Sbjct: 295 ALFLWASGSELTSILEADHMPNKYIPKDLRKELEKVIPGLRPWEV 339 Score = 44.7 bits (104), Expect(2) = 5e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 210 QNEAYESNRRDIAVPEANDGIWPGV 136 Q EAYES RRD+AV EAN G+WPGV Sbjct: 265 QEEAYESKRRDLAVLEANGGVWPGV 289