BLASTX nr result
ID: Chrysanthemum22_contig00015031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00015031 (874 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022039367.1| uncharacterized protein LOC110941970 [Helian... 58 9e-06 >ref|XP_022039367.1| uncharacterized protein LOC110941970 [Helianthus annuus] gb|OTG26392.1| putative alpha/beta-Hydrolases superfamily protein [Helianthus annuus] Length = 375 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = +2 Query: 119 AAKKSSVKPTVIVVVAPTWSGLLPIVFGSDSNTESR 226 AAKK VKPT I VAPTWSG LPIVFG DS TESR Sbjct: 189 AAKKGLVKPTAIAAVAPTWSGPLPIVFGRDSKTESR 224