BLASTX nr result
ID: Chrysanthemum22_contig00014592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00014592 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF93087.1| putative kinesin motor domain-containing protein ... 55 6e-06 ref|XP_022020188.1| kinesin-like protein KIN-7K, chloroplastic [... 55 6e-06 >gb|OTF93087.1| putative kinesin motor domain-containing protein [Helianthus annuus] Length = 783 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 402 VAKLKRSQGDETEPSELSKDSQRVDGWDLI*FRS 301 VAKLKR QG+E+EPSE S++SQRVDGWDLI RS Sbjct: 746 VAKLKRPQGEESEPSESSRESQRVDGWDLISCRS 779 >ref|XP_022020188.1| kinesin-like protein KIN-7K, chloroplastic [Helianthus annuus] Length = 821 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 402 VAKLKRSQGDETEPSELSKDSQRVDGWDLI*FRS 301 VAKLKR QG+E+EPSE S++SQRVDGWDLI RS Sbjct: 784 VAKLKRPQGEESEPSESSRESQRVDGWDLISCRS 817