BLASTX nr result
ID: Chrysanthemum22_contig00014545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00014545 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021980928.1| uncharacterized protein LOC110877078 [Helian... 74 4e-13 ref|XP_020873737.1| uncharacterized protein LOC9305691 isoform X... 67 1e-10 gb|PKI51405.1| hypothetical protein CRG98_028201 [Punica granatum] 67 1e-10 ref|XP_023735990.1| uncharacterized protein LOC111883889 isoform... 67 1e-10 ref|XP_023735989.1| uncharacterized protein LOC111883889 isoform... 67 2e-10 ref|XP_023735988.1| uncharacterized protein LOC111883889 isoform... 67 2e-10 ref|XP_002867574.1| uncharacterized protein LOC9305691 isoform X... 66 2e-10 ref|NP_567740.1| histone-lysine N-methyltransferase [Arabidopsis... 66 2e-10 ref|XP_013738096.1| uncharacterized protein LOC106440877 [Brassi... 66 2e-10 ref|XP_009137584.1| PREDICTED: uncharacterized protein LOC103861... 66 2e-10 ref|XP_013705199.1| uncharacterized protein BNAC07G40140D [Brass... 66 2e-10 emb|CDY42750.1| BnaA03g47890D [Brassica napus] 66 2e-10 ref|XP_013593997.1| PREDICTED: uncharacterized protein LOC106302... 66 2e-10 ref|XP_020873736.1| uncharacterized protein LOC9305691 isoform X... 66 3e-10 gb|OTG30127.1| hypothetical protein HannXRQ_Chr03g0061021 [Helia... 64 3e-10 ref|XP_006284557.1| uncharacterized protein LOC17878907 [Capsell... 65 4e-10 ref|XP_021862011.1| uncharacterized protein LOC110801008 [Spinac... 65 5e-10 emb|CDP03211.1| unnamed protein product [Coffea canephora] 65 6e-10 ref|XP_010448304.1| PREDICTED: uncharacterized protein LOC104730... 64 1e-09 ref|XP_010438784.1| PREDICTED: uncharacterized protein LOC104722... 64 1e-09 >ref|XP_021980928.1| uncharacterized protein LOC110877078 [Helianthus annuus] gb|OTG13473.1| hypothetical protein HannXRQ_Chr09g0238511 [Helianthus annuus] Length = 195 Score = 73.6 bits (179), Expect = 4e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 LGPLSGAGFCLYVDTLLNESSEEVK+LR YMYAYK+R Sbjct: 159 LGPLSGAGFCLYVDTLLNESSEEVKKLRGYMYAYKSR 195 >ref|XP_020873737.1| uncharacterized protein LOC9305691 isoform X2 [Arabidopsis lyrata subsp. lyrata] Length = 207 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR*LK 354 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR +K Sbjct: 163 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKARFMK 201 >gb|PKI51405.1| hypothetical protein CRG98_028201 [Punica granatum] Length = 198 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKA 366 LGPLSGAG CLYVD LLNESSEEVK+LR YMYAYKA Sbjct: 162 LGPLSGAGICLYVDHLLNESSEEVKKLRAYMYAYKA 197 >ref|XP_023735990.1| uncharacterized protein LOC111883889 isoform X3 [Lactuca sativa] Length = 188 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 LGPLSGAGF LYVD L+NESSEEVK+LRNYMY+YK+R Sbjct: 152 LGPLSGAGFGLYVDHLMNESSEEVKKLRNYMYSYKSR 188 >ref|XP_023735989.1| uncharacterized protein LOC111883889 isoform X2 [Lactuca sativa] Length = 193 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 LGPLSGAGF LYVD L+NESSEEVK+LRNYMY+YK+R Sbjct: 157 LGPLSGAGFGLYVDHLMNESSEEVKKLRNYMYSYKSR 193 >ref|XP_023735988.1| uncharacterized protein LOC111883889 isoform X1 [Lactuca sativa] gb|PLY72205.1| hypothetical protein LSAT_7X38121 [Lactuca sativa] Length = 199 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 LGPLSGAGF LYVD L+NESSEEVK+LRNYMY+YK+R Sbjct: 163 LGPLSGAGFGLYVDHLMNESSEEVKKLRNYMYSYKSR 199 >ref|XP_002867574.1| uncharacterized protein LOC9305691 isoform X3 [Arabidopsis lyrata subsp. lyrata] gb|EFH43833.1| hypothetical protein ARALYDRAFT_913938 [Arabidopsis lyrata subsp. lyrata] Length = 198 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 163 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 198 >ref|NP_567740.1| histone-lysine N-methyltransferase [Arabidopsis thaliana] gb|AAL91246.1| unknown protein [Arabidopsis thaliana] gb|AAM62523.1| unknown [Arabidopsis thaliana] gb|AAM91248.1| unknown protein [Arabidopsis thaliana] gb|AEE85174.1| histone-lysine N-methyltransferase [Arabidopsis thaliana] gb|OAO96680.1| hypothetical protein AXX17_AT4G30250 [Arabidopsis thaliana] Length = 198 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 163 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 198 >ref|XP_013738096.1| uncharacterized protein LOC106440877 [Brassica napus] Length = 200 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 165 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 200 >ref|XP_009137584.1| PREDICTED: uncharacterized protein LOC103861618 [Brassica rapa] Length = 200 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 165 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 200 >ref|XP_013705199.1| uncharacterized protein BNAC07G40140D [Brassica napus] Length = 200 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 165 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 200 >emb|CDY42750.1| BnaA03g47890D [Brassica napus] Length = 200 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 165 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 200 >ref|XP_013593997.1| PREDICTED: uncharacterized protein LOC106302029 [Brassica oleracea var. oleracea] Length = 201 Score = 66.2 bits (160), Expect = 2e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 166 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 201 >ref|XP_020873736.1| uncharacterized protein LOC9305691 isoform X1 [Arabidopsis lyrata subsp. lyrata] Length = 214 Score = 66.2 bits (160), Expect = 3e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 163 GPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR 198 >gb|OTG30127.1| hypothetical protein HannXRQ_Chr03g0061021 [Helianthus annuus] Length = 97 Score = 63.5 bits (153), Expect = 3e-10 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPLSGAG CLY+D L NESSEEVK+L++YMY YKAR Sbjct: 62 GPLSGAGLCLYLDALFNESSEEVKKLQSYMYTYKAR 97 >ref|XP_006284557.1| uncharacterized protein LOC17878907 [Capsella rubella] gb|EOA17455.1| hypothetical protein CARUB_v10005778mg [Capsella rubella] Length = 198 Score = 65.5 bits (158), Expect = 4e-10 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYKAR Sbjct: 163 GPLCGAGTCLYVDHLLEESSEEVKKLRNYMYAYKAR 198 >ref|XP_021862011.1| uncharacterized protein LOC110801008 [Spinacia oleracea] gb|KNA20208.1| hypothetical protein SOVF_054490 [Spinacia oleracea] Length = 201 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKA 366 GPLSGAG CLYVD LL+ESSEEV++LRNYMYAYKA Sbjct: 166 GPLSGAGICLYVDHLLHESSEEVRKLRNYMYAYKA 200 >emb|CDP03211.1| unnamed protein product [Coffea canephora] Length = 194 Score = 65.1 bits (157), Expect = 6e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 473 LGPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKA 366 LGPLSGAG CLYVD LLNESSEEV++LR YMY+YKA Sbjct: 158 LGPLSGAGVCLYVDHLLNESSEEVRKLRGYMYSYKA 193 >ref|XP_010448304.1| PREDICTED: uncharacterized protein LOC104730785 [Camelina sativa] Length = 198 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYK+R Sbjct: 163 GPLCGAGTCLYVDHLLEESSEEVKKLRNYMYAYKSR 198 >ref|XP_010438784.1| PREDICTED: uncharacterized protein LOC104722332 [Camelina sativa] Length = 198 Score = 64.3 bits (155), Expect = 1e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 470 GPLSGAGFCLYVDTLLNESSEEVKQLRNYMYAYKAR 363 GPL GAG CLYVD LL ESSEEVK+LRNYMYAYK+R Sbjct: 163 GPLCGAGTCLYVDHLLEESSEEVKKLRNYMYAYKSR 198