BLASTX nr result
ID: Chrysanthemum22_contig00014409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00014409 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022015552.1| carbamoyl-phosphate synthase small chain, ch... 76 1e-13 gb|KVH96449.1| Carbamoyl-phosphate synthase, small subunit [Cyna... 74 5e-13 ref|XP_022037140.1| carbamoyl-phosphate synthase small chain, ch... 74 7e-13 ref|XP_022037139.1| carbamoyl-phosphate synthase small chain, ch... 74 8e-13 ref|XP_023763732.1| carbamoyl-phosphate synthase small chain, ch... 71 7e-12 ref|XP_011099799.1| carbamoyl-phosphate synthase small chain, ch... 67 2e-10 gb|PIN11565.1| Carbamoyl-phosphate synthase (glutamine-hydrolyzi... 65 7e-10 ref|XP_017248072.1| PREDICTED: carbamoyl-phosphate synthase smal... 63 5e-09 ref|XP_017248070.1| PREDICTED: carbamoyl-phosphate synthase smal... 63 5e-09 gb|EPS72353.1| hypothetical protein M569_02404, partial [Genlise... 63 6e-09 ref|XP_012829965.1| PREDICTED: carbamoyl-phosphate synthase smal... 63 6e-09 emb|CAP74552.1| putative TdLFC69 protein, partial [Triticum turg... 59 1e-08 ref|XP_019197744.1| PREDICTED: carbamoyl-phosphate synthase smal... 62 1e-08 ref|XP_019199814.1| PREDICTED: carbamoyl-phosphate synthase smal... 62 1e-08 ref|XP_022989099.1| carbamoyl-phosphate synthase small chain, ch... 62 1e-08 gb|KZV17306.1| carbamoyl-phosphate synthase small chain, chlorop... 62 2e-08 ref|XP_023514547.1| carbamoyl-phosphate synthase small chain, ch... 62 2e-08 ref|XP_022957422.1| carbamoyl-phosphate synthase small chain, ch... 62 2e-08 gb|ERN15913.1| hypothetical protein AMTR_s00039p00223010 [Ambore... 61 2e-08 gb|PHT52113.1| Carbamoyl-phosphate synthase small chain, chlorop... 61 2e-08 >ref|XP_022015552.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Helianthus annuus] gb|OTF91112.1| putative carbamoyl-phosphate synthase small chain [Helianthus annuus] Length = 426 Score = 76.3 bits (186), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 QKLMSLQYHPEASPGPHDSDLVFDHFVELMR+EK+S+ Sbjct: 390 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRREKQSS 426 >gb|KVH96449.1| Carbamoyl-phosphate synthase, small subunit [Cynara cardunculus var. scolymus] Length = 426 Score = 74.3 bits (181), Expect = 5e-13 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 +KLMSLQYHPEASPGPHDSD+VFDHF+ELMR+EK+ST Sbjct: 390 RKLMSLQYHPEASPGPHDSDMVFDHFMELMRREKQST 426 >ref|XP_022037140.1| carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X2 [Helianthus annuus] gb|OTG24080.1| putative carbamoyl-phosphate synthase small chain [Helianthus annuus] Length = 423 Score = 73.9 bits (180), Expect = 7e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKK 268 +KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK+ Sbjct: 387 RKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKQ 421 >ref|XP_022037139.1| carbamoyl-phosphate synthase small chain, chloroplastic-like isoform X1 [Helianthus annuus] Length = 451 Score = 73.9 bits (180), Expect = 8e-13 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKK 268 +KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK+ Sbjct: 415 RKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKQ 449 >ref|XP_023763732.1| carbamoyl-phosphate synthase small chain, chloroplastic [Lactuca sativa] Length = 426 Score = 71.2 bits (173), Expect = 7e-12 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 QKLMSLQYHPEASPGPHDSDLVFD F+ELM++EK ST Sbjct: 390 QKLMSLQYHPEASPGPHDSDLVFDDFMELMKREKAST 426 >ref|XP_011099799.1| carbamoyl-phosphate synthase small chain, chloroplastic [Sesamum indicum] Length = 427 Score = 67.0 bits (162), Expect = 2e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 QKLMSLQYHPEASPGPHDSDLVF F+ELM++E++ T Sbjct: 391 QKLMSLQYHPEASPGPHDSDLVFGEFIELMKQERQRT 427 >gb|PIN11565.1| Carbamoyl-phosphate synthase (glutamine-hydrolyzing) [Handroanthus impetiginosus] Length = 427 Score = 65.5 bits (158), Expect = 7e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKK 268 QKLMSLQYHPEASPGPHDSDLVF FV+LM++EK+ Sbjct: 391 QKLMSLQYHPEASPGPHDSDLVFGDFVQLMKQEKQ 425 >ref|XP_017248072.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X2 [Daucus carota subsp. sativus] Length = 431 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKS 265 +KLMSLQYHPEASPGPHDSD VF+ FV+LM++EK++ Sbjct: 395 RKLMSLQYHPEASPGPHDSDPVFEEFVKLMKREKQN 430 >ref|XP_017248070.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X1 [Daucus carota subsp. sativus] ref|XP_017248071.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic isoform X1 [Daucus carota subsp. sativus] Length = 432 Score = 63.2 bits (152), Expect = 5e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKS 265 +KLMSLQYHPEASPGPHDSD VF+ FV+LM++EK++ Sbjct: 396 RKLMSLQYHPEASPGPHDSDPVFEEFVKLMKREKQN 431 >gb|EPS72353.1| hypothetical protein M569_02404, partial [Genlisea aurea] Length = 381 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK 271 +KL+SLQYHPEASPGPHDSDLVF+ FV LM++EK Sbjct: 348 RKLLSLQYHPEASPGPHDSDLVFEDFVRLMKQEK 381 >ref|XP_012829965.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic [Erythranthe guttata] gb|EYU43489.1| hypothetical protein MIMGU_mgv1a006980mg [Erythranthe guttata] Length = 424 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKK 268 QKLMSLQYHPEASPGPHDSD VF F++LM++EK+ Sbjct: 388 QKLMSLQYHPEASPGPHDSDPVFGEFIQLMKQEKQ 422 >emb|CAP74552.1| putative TdLFC69 protein, partial [Triticum turgidum subsp. durum] Length = 94 Score = 58.5 bits (140), Expect = 1e-08 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 369 KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK 271 KLMSLQYHPE+SPGPHDSDL F FVELM+ + Sbjct: 61 KLMSLQYHPESSPGPHDSDLAFGEFVELMKNNR 93 >ref|XP_019197744.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like [Ipomoea nil] Length = 427 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK 271 QKLM+LQYHPEASPGPHDSD VF FV+LM+KE+ Sbjct: 391 QKLMALQYHPEASPGPHDSDNVFGEFVQLMKKER 424 >ref|XP_019199814.1| PREDICTED: carbamoyl-phosphate synthase small chain, chloroplastic-like [Ipomoea nil] Length = 428 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK 271 QKLMSLQYHPEASPGPHDSDLVF F++LM++ + Sbjct: 394 QKLMSLQYHPEASPGPHDSDLVFAEFIQLMKRNR 427 >ref|XP_022989099.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita maxima] ref|XP_022989108.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita maxima] ref|XP_022989117.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita maxima] Length = 432 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = -1 Query: 369 KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 K+MSLQYHPEASPGPHDSD VF FVE+M++EK+++ Sbjct: 397 KIMSLQYHPEASPGPHDSDSVFGDFVEMMKQEKRNS 432 >gb|KZV17306.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Dorcoceras hygrometricum] Length = 422 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKS 265 QKLMSLQYHPEASPGPHDSD VF F+ LM++E++S Sbjct: 386 QKLMSLQYHPEASPGPHDSDPVFGDFIHLMKQEQQS 421 >ref|XP_023514547.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 432 Score = 61.6 bits (148), Expect = 2e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -1 Query: 369 KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 K+MSLQYHPEASPGPHDSD VF F+E+M++EK+++ Sbjct: 397 KIMSLQYHPEASPGPHDSDSVFGDFIEMMKQEKRNS 432 >ref|XP_022957422.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita moschata] ref|XP_022957423.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita moschata] ref|XP_022957424.1| carbamoyl-phosphate synthase small chain, chloroplastic-like [Cucurbita moschata] Length = 432 Score = 61.6 bits (148), Expect = 2e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -1 Query: 369 KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 K+MSLQYHPEASPGPHDSD VF F+E+M++EK+++ Sbjct: 397 KIMSLQYHPEASPGPHDSDSVFGDFIEMMKQEKRNS 432 >gb|ERN15913.1| hypothetical protein AMTR_s00039p00223010 [Amborella trichopoda] Length = 425 Score = 61.2 bits (147), Expect = 2e-08 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = -1 Query: 372 QKLMSLQYHPEASPGPHDSDLVFDHFVELMRKEKKST 262 QK+MSLQYHPEASPGPHDSD VF FV++M++ K+++ Sbjct: 389 QKMMSLQYHPEASPGPHDSDTVFKEFVDMMKQNKQAS 425 >gb|PHT52113.1| Carbamoyl-phosphate synthase small chain, chloroplastic [Capsicum baccatum] Length = 426 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 369 KLMSLQYHPEASPGPHDSDLVFDHFVELMRKEK 271 KLMSLQYHPEASPGPHDSD VF F++LM++EK Sbjct: 391 KLMSLQYHPEASPGPHDSDTVFGEFIQLMKQEK 423