BLASTX nr result
ID: Chrysanthemum22_contig00014076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00014076 (586 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH89468.1| Cysteine peptidase, asparagine active site-contai... 80 4e-14 ref|XP_012459328.1| PREDICTED: senescence-specific cysteine prot... 77 4e-14 gb|PPD81213.1| hypothetical protein GOBAR_DD21868 [Gossypium bar... 76 5e-14 gb|KDP23193.1| hypothetical protein JCGZ_00326 [Jatropha curcas] 74 7e-14 gb|KVH95965.1| Cysteine peptidase, asparagine active site-contai... 75 1e-13 ref|XP_022026895.1| senescence-specific cysteine protease SAG39-... 78 1e-13 ref|XP_022036665.1| senescence-specific cysteine protease SAG39-... 78 1e-13 ref|XP_022036666.1| senescence-specific cysteine protease SAG39-... 78 1e-13 ref|XP_022037393.1| senescence-specific cysteine protease SAG39-... 78 1e-13 gb|POE64100.1| kdel-tailed cysteine endopeptidase cep1 [Quercus ... 74 2e-13 ref|XP_022773772.1| senescence-specific cysteine protease SAG39-... 77 2e-13 ref|XP_021274018.1| senescence-specific cysteine protease SAG39-... 77 2e-13 ref|XP_017969445.1| PREDICTED: senescence-specific cysteine prot... 77 2e-13 ref|XP_007048792.2| PREDICTED: senescence-specific cysteine prot... 77 2e-13 gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao] 77 2e-13 gb|OTF92150.1| putative peptidase C1A [Helianthus annuus] 72 3e-13 ref|XP_006469012.1| PREDICTED: senescence-specific cysteine prot... 77 3e-13 ref|XP_006446792.1| senescence-specific cysteine protease SAG39 ... 77 3e-13 gb|PPD81210.1| hypothetical protein GOBAR_DD21865 [Gossypium bar... 77 3e-13 gb|PPD81211.1| hypothetical protein GOBAR_DD21866 [Gossypium bar... 77 3e-13 >gb|KVH89468.1| Cysteine peptidase, asparagine active site-containing protein [Cynara cardunculus var. scolymus] Length = 509 Score = 80.5 bits (197), Expect = 4e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA Sbjct: 474 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 509 >ref|XP_012459328.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Gossypium raimondii] gb|KJB75476.1| hypothetical protein B456_012G043300 [Gossypium raimondii] Length = 185 Score = 77.0 bits (188), Expect = 4e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWG+SWGEEGYIRMQRDVEAKEGLCGIAM ASYPTA Sbjct: 150 SWGSSWGEEGYIRMQRDVEAKEGLCGIAMQASYPTA 185 >gb|PPD81213.1| hypothetical protein GOBAR_DD21868 [Gossypium barbadense] Length = 149 Score = 75.9 bits (185), Expect = 5e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWG+SWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 114 SWGSSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 149 >gb|KDP23193.1| hypothetical protein JCGZ_00326 [Jatropha curcas] Length = 94 Score = 73.9 bits (180), Expect = 7e-14 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGE+GYIRMQRD++AKEGLCGIAM SYPTA Sbjct: 59 SWGTSWGEDGYIRMQRDIDAKEGLCGIAMQPSYPTA 94 >gb|KVH95965.1| Cysteine peptidase, asparagine active site-containing protein [Cynara cardunculus var. scolymus] Length = 152 Score = 75.1 bits (183), Expect = 1e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYI MQRDV+AKEGLCGIAM ASYPTA Sbjct: 117 SWGTSWGEEGYIMMQRDVDAKEGLCGIAMQASYPTA 152 >ref|XP_022026895.1| senescence-specific cysteine protease SAG39-like [Helianthus annuus] gb|OTG31036.1| putative senescence-specific cysteine protease SAG39 [Helianthus annuus] Length = 343 Score = 78.2 bits (191), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGT WGEEGYIRMQRDVEAKEGLCGIAMMASYPTA Sbjct: 308 SWGTVWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 343 >ref|XP_022036665.1| senescence-specific cysteine protease SAG39-like [Helianthus annuus] gb|OTG25693.1| putative peptidase C1A [Helianthus annuus] Length = 343 Score = 78.2 bits (191), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGT WGEEGYIRMQRDVEAKEGLCGIAMMASYPTA Sbjct: 308 SWGTVWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 343 >ref|XP_022036666.1| senescence-specific cysteine protease SAG39-like [Helianthus annuus] gb|OTG25695.1| putative peptidase C1A [Helianthus annuus] Length = 343 Score = 78.2 bits (191), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGT WGEEGYIRMQRDVEAKEGLCGIAMMASYPTA Sbjct: 308 SWGTVWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 343 >ref|XP_022037393.1| senescence-specific cysteine protease SAG39-like [Helianthus annuus] gb|OTG24394.1| putative peptidase C1A [Helianthus annuus] Length = 343 Score = 78.2 bits (191), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGT WGEEGYIRMQRDVEAKEGLCGIAMMASYPTA Sbjct: 308 SWGTVWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 343 >gb|POE64100.1| kdel-tailed cysteine endopeptidase cep1 [Quercus suber] Length = 141 Score = 74.3 bits (181), Expect = 2e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRD++AKEGLCGIAM +SYPTA Sbjct: 106 SWGTSWGEEGYIRMQRDIKAKEGLCGIAMDSSYPTA 141 >ref|XP_022773772.1| senescence-specific cysteine protease SAG39-like [Durio zibethinus] Length = 341 Score = 77.4 bits (189), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 306 SWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 341 >ref|XP_021274018.1| senescence-specific cysteine protease SAG39-like [Herrania umbratica] Length = 343 Score = 77.4 bits (189), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 308 SWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 343 >ref|XP_017969445.1| PREDICTED: senescence-specific cysteine protease SAG39 [Theobroma cacao] Length = 343 Score = 77.4 bits (189), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 308 SWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 343 >ref|XP_007048792.2| PREDICTED: senescence-specific cysteine protease SAG39 [Theobroma cacao] Length = 343 Score = 77.4 bits (189), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 308 SWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 343 >gb|EOX92949.1| Senescence-associated gene 12 [Theobroma cacao] Length = 343 Score = 77.4 bits (189), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRDV+AKEGLCGIAM ASYPTA Sbjct: 308 SWGTSWGEEGYIRMQRDVDAKEGLCGIAMQASYPTA 343 >gb|OTF92150.1| putative peptidase C1A [Helianthus annuus] Length = 92 Score = 72.4 bits (176), Expect = 3e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGT+WGEEGYIRMQRDV ++ GLCGIAMMASYPTA Sbjct: 57 SWGTTWGEEGYIRMQRDVASENGLCGIAMMASYPTA 92 >ref|XP_006469012.1| PREDICTED: senescence-specific cysteine protease SAG39-like [Citrus sinensis] Length = 341 Score = 77.0 bits (188), Expect = 3e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRD++AKEGLCGIAM ASYPTA Sbjct: 306 SWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA 341 >ref|XP_006446792.1| senescence-specific cysteine protease SAG39 [Citrus clementina] gb|ESR60032.1| hypothetical protein CICLE_v10018253mg [Citrus clementina] Length = 341 Score = 77.0 bits (188), Expect = 3e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWGTSWGEEGYIRMQRD++AKEGLCGIAM ASYPTA Sbjct: 306 SWGTSWGEEGYIRMQRDIDAKEGLCGIAMQASYPTA 341 >gb|PPD81210.1| hypothetical protein GOBAR_DD21865 [Gossypium barbadense] Length = 342 Score = 77.0 bits (188), Expect = 3e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWG+SWGEEGYIRMQRDVEAKEGLCGIAM ASYPTA Sbjct: 307 SWGSSWGEEGYIRMQRDVEAKEGLCGIAMQASYPTA 342 >gb|PPD81211.1| hypothetical protein GOBAR_DD21866 [Gossypium barbadense] Length = 342 Score = 77.0 bits (188), Expect = 3e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 1 SWGTSWGEEGYIRMQRDVEAKEGLCGIAMMASYPTA 108 SWG+SWGEEGYIRMQRDVEAKEGLCGIAM ASYPTA Sbjct: 307 SWGSSWGEEGYIRMQRDVEAKEGLCGIAMQASYPTA 342