BLASTX nr result
ID: Chrysanthemum22_contig00013986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013986 (1007 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI08081.1| Pentatricopeptide repeat-containing protein [Cyna... 68 9e-09 ref|XP_021983887.1| pentatricopeptide repeat-containing protein ... 63 5e-07 >gb|KVI08081.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 1062 Score = 68.2 bits (165), Expect = 9e-09 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 1005 TYNTIIFCLTKENRVHDTFWFFHQMKKMLNPDCV 904 TYNTIIF LTKENRV D FWFF+QMKKMLNPDCV Sbjct: 598 TYNTIIFGLTKENRVEDAFWFFNQMKKMLNPDCV 631 >ref|XP_021983887.1| pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Helianthus annuus] gb|OTG16363.1| putative proton gradient regulation 3 [Helianthus annuus] Length = 1099 Score = 62.8 bits (151), Expect = 5e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 1005 TYNTIIFCLTKENRVHDTFWFFHQMKKMLNPDCV 904 TYNTII+ LTKENRV D FWFFHQMKK +PDCV Sbjct: 630 TYNTIIYGLTKENRVLDAFWFFHQMKKSFSPDCV 663