BLASTX nr result
ID: Chrysanthemum22_contig00013436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013436 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023733579.1| BTB/POZ and TAZ domain-containing protein 1-... 75 1e-12 gb|KVH98154.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 74 2e-12 gb|PLY74004.1| hypothetical protein LSAT_1X28741 [Lactuca sativa] 66 1e-09 ref|XP_022012194.1| BTB/POZ and TAZ domain-containing protein 1-... 64 9e-09 >ref|XP_023733579.1| BTB/POZ and TAZ domain-containing protein 1-like [Lactuca sativa] Length = 357 Score = 74.7 bits (182), Expect = 1e-12 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +2 Query: 2 KEEARWELLVTKVVAAKAISSLPLPKRKLEQEQQPRSLVHKTLNHHVSVAC 154 KEEARWELLV KVVAAKAISSL LP RK EQ++QPRSL +N+HVSVAC Sbjct: 308 KEEARWELLVRKVVAAKAISSLSLPMRKREQQEQPRSL-RDAMNNHVSVAC 357 >gb|KVH98154.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 366 Score = 74.3 bits (181), Expect = 2e-12 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 2/53 (3%) Frame = +2 Query: 2 KEEARWELLVTKVVAAKAISSLPLPKRK--LEQEQQPRSLVHKTLNHHVSVAC 154 KEEARWELLV KVVAAKAISSLPLPKRK +QEQ+PRS + NHHVSV C Sbjct: 318 KEEARWELLVRKVVAAKAISSLPLPKRKRDQDQEQEPRSFI----NHHVSVVC 366 >gb|PLY74004.1| hypothetical protein LSAT_1X28741 [Lactuca sativa] Length = 384 Score = 66.2 bits (160), Expect = 1e-09 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +2 Query: 2 KEEARWELLVTKVVAAKAISSLPLPKRKLEQEQQPRSLVHKTLNHHVS 145 KEEARWELLV KVVAAKAISSL LP RK EQ++QPRSL +N+H S Sbjct: 308 KEEARWELLVRKVVAAKAISSLSLPMRKREQQEQPRSL-RDAMNNHFS 354 >ref|XP_022012194.1| BTB/POZ and TAZ domain-containing protein 1-like [Helianthus annuus] gb|OTG33489.1| putative zinc finger, TAZ-type, SKP1/BTB/POZ domain protein [Helianthus annuus] Length = 363 Score = 63.9 bits (154), Expect = 9e-09 Identities = 35/56 (62%), Positives = 42/56 (75%), Gaps = 5/56 (8%) Frame = +2 Query: 2 KEEARWELLVTKVVAAKAISSLPLPKRKL-----EQEQQPRSLVHKTLNHHVSVAC 154 KEEARWELLV KV AAKA+SS+ LPK K+ EQE++PRS + +N HVSVAC Sbjct: 309 KEEARWELLVRKVEAAKAVSSVSLPKTKIEHQDYEQEEEPRSF-REAMNCHVSVAC 363