BLASTX nr result
ID: Chrysanthemum22_contig00013409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013409 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021970120.1| DNA repair RAD52-like protein 2, chloroplast... 54 6e-06 >ref|XP_021970120.1| DNA repair RAD52-like protein 2, chloroplastic [Helianthus annuus] gb|OTG22790.1| hypothetical protein HannXRQ_Chr06g0175341 [Helianthus annuus] Length = 225 Score = 53.5 bits (127), Expect = 6e-06 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = -1 Query: 107 ASSKSRVGSGVPSSNYVVPFDSS-SCITRPLAEILR 3 +++K + GS VP+SNYVVPFDSS SCITRPL EILR Sbjct: 76 SNTKGKTGSAVPNSNYVVPFDSSPSCITRPLIEILR 111