BLASTX nr result
ID: Chrysanthemum22_contig00013253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013253 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI09215.1| Phosphoribulokinase/uridine kinase [Cynara cardun... 56 1e-06 ref|XP_023741020.1| uridine kinase-like protein 1, chloroplastic... 55 3e-06 ref|XP_022005578.1| uridine kinase-like protein 1, chloroplastic... 54 7e-06 >gb|KVI09215.1| Phosphoribulokinase/uridine kinase [Cynara cardunculus var. scolymus] Length = 489 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = +2 Query: 215 KKLASFFSVIDAFNINQMLECIEKLKQGNLVQLHIYDFINHCRSSKS 355 KK+ F +DAF+ QMLEC+EKLKQGN V L IYDF NH R S+S Sbjct: 121 KKMPLF---VDAFDTEQMLECVEKLKQGNPVHLPIYDFKNHRRCSES 164 >ref|XP_023741020.1| uridine kinase-like protein 1, chloroplastic [Lactuca sativa] gb|PLY96821.1| hypothetical protein LSAT_2X94120 [Lactuca sativa] Length = 469 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 245 DAFNINQMLECIEKLKQGNLVQLHIYDFINHCRSSKS 355 DAF+ QMLEC+EKLKQGN V L IYDF NH R S+S Sbjct: 106 DAFDTEQMLECVEKLKQGNSVHLPIYDFKNHRRCSES 142 >ref|XP_022005578.1| uridine kinase-like protein 1, chloroplastic [Helianthus annuus] gb|OTF98896.1| putative uridine kinase/uracil phosphoribosyltransferase 1 [Helianthus annuus] Length = 487 Score = 53.9 bits (128), Expect = 7e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 245 DAFNINQMLECIEKLKQGNLVQLHIYDFINHCRSSKS 355 DAF+ QMLECIEKLK+GN V L IYDF NH R S+S Sbjct: 124 DAFDTEQMLECIEKLKKGNSVHLPIYDFKNHRRCSES 160