BLASTX nr result
ID: Chrysanthemum22_contig00013236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013236 (760 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023735558.1| classical arabinogalactan protein 2-like [La... 65 2e-09 ref|XP_023762319.1| classical arabinogalactan protein 4-like [La... 57 1e-06 >ref|XP_023735558.1| classical arabinogalactan protein 2-like [Lactuca sativa] gb|PLY72554.1| hypothetical protein LSAT_2X65780 [Lactuca sativa] Length = 133 Score = 64.7 bits (156), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 440 DLPPSGTFADGWVNRAVIAGTALAGAFVSVTLM 538 DLPPSGTF DGWVNRAVIAGTALAGAF +VTLM Sbjct: 101 DLPPSGTFVDGWVNRAVIAGTALAGAFFAVTLM 133 >ref|XP_023762319.1| classical arabinogalactan protein 4-like [Lactuca sativa] Length = 126 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +2 Query: 449 PSGTFADGWVNRAVIAGTALAGAFVSVTLM 538 PSG+FADGWVNRAVIAGTA+AG+F++VTLM Sbjct: 97 PSGSFADGWVNRAVIAGTAVAGSFLAVTLM 126