BLASTX nr result
ID: Chrysanthemum22_contig00013079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013079 (2887 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023739421.1| protein RRP6-like 2 [Lactuca sativa] 70 1e-08 gb|PLY69523.1| hypothetical protein LSAT_6X31721 [Lactuca sativa] 70 1e-08 gb|OTG09621.1| putative HRDC domain-containing protein [Helianth... 65 2e-08 ref|XP_022005926.1| protein RRP6-like 2 [Helianthus annuus] >gi|... 68 1e-07 gb|OTG11894.1| putative ribonuclease D, HRDC-like protein [Helia... 65 1e-07 dbj|BAB09932.1| nucleolar protein-like [Arabidopsis thaliana] 67 1e-07 ref|XP_021888710.1| protein RRP6-like 2 isoform X2 [Carica papaya] 67 1e-07 ref|XP_021888709.1| protein RRP6-like 2 isoform X1 [Carica papaya] 67 1e-07 gb|OMO67884.1| hypothetical protein CCACVL1_20240 [Corchorus cap... 67 2e-07 gb|OMO70391.1| hypothetical protein COLO4_28619 [Corchorus olito... 67 2e-07 dbj|GAV88737.1| LOW QUALITY PROTEIN: HRDC domain-containing prot... 67 2e-07 gb|EOY10516.1| Polynucleotidyl transferase, ribonuclease H fold ... 67 2e-07 ref|XP_007204663.2| protein RRP6-like 2 [Prunus persica] >gi|113... 67 2e-07 ref|XP_021281829.1| protein RRP6-like 2 [Herrania umbratica] 67 2e-07 ref|XP_007030013.2| PREDICTED: protein RRP6-like 2 [Theobroma ca... 67 2e-07 gb|EOY10515.1| Polynucleotidyl transferase, putative isoform 1 [... 67 2e-07 gb|KFK35633.1| hypothetical protein AALP_AA4G016400 [Arabis alpina] 67 2e-07 gb|KFK35634.1| hypothetical protein AALP_AA4G016400 [Arabis alpina] 67 2e-07 dbj|BAJ98461.1| predicted protein, partial [Hordeum vulgare subs... 66 2e-07 dbj|BAJ99123.1| predicted protein, partial [Hordeum vulgare subs... 66 3e-07 >ref|XP_023739421.1| protein RRP6-like 2 [Lactuca sativa] Length = 710 Score = 70.5 bits (171), Expect = 1e-08 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 141 VKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 V ALC+WRDIVAR +DESTGYVLPNK LIEIAKKMP T +L G+L Sbjct: 483 VVAALCEWRDIVARAEDESTGYVLPNKILIEIAKKMPITNEDLRGLL 529 >gb|PLY69523.1| hypothetical protein LSAT_6X31721 [Lactuca sativa] Length = 716 Score = 70.5 bits (171), Expect = 1e-08 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 141 VKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 V ALC+WRDIVAR +DESTGYVLPNK LIEIAKKMP T +L G+L Sbjct: 483 VVAALCEWRDIVARAEDESTGYVLPNKILIEIAKKMPITNEDLRGLL 529 >gb|OTG09621.1| putative HRDC domain-containing protein [Helianthus annuus] Length = 163 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + LCQWRD++AR++DESTGY+LP K LIEIAK+MP T G+L +L Sbjct: 64 LAIVAGLCQWRDVIARSEDESTGYLLPYKVLIEIAKQMPVTTGKLQHLL 112 >ref|XP_022005926.1| protein RRP6-like 2 [Helianthus annuus] gb|OTF99167.1| putative ribonuclease D, Exosome-associated factor Rrp6 [Helianthus annuus] Length = 874 Score = 67.8 bits (164), Expect = 1e-07 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + LC+WRD++AR++DESTGY+LPNK LIEIAK+MP T G+L +L Sbjct: 481 LAIVAGLCEWRDVIARSEDESTGYILPNKVLIEIAKQMPVTTGKLRHLL 529 >gb|OTG11894.1| putative ribonuclease D, HRDC-like protein [Helianthus annuus] Length = 270 Score = 65.1 bits (157), Expect = 1e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -2 Query: 135 QALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 Q LC+W DI+AR++DEST Y+LPNK LIEIAK+MP T G+L +L Sbjct: 221 QGLCEWSDIIARSEDESTSYILPNKVLIEIAKQMPVTTGKLRHLL 265 >dbj|BAB09932.1| nucleolar protein-like [Arabidopsis thaliana] Length = 834 Score = 67.4 bits (163), Expect = 1e-07 Identities = 30/48 (62%), Positives = 39/48 (81%) Frame = -2 Query: 144 IVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 IV LC+WRD +AR +DESTGYVLPNK L+EIAK+MP ++G+L +L Sbjct: 448 IVAVGLCEWRDFIARAEDESTGYVLPNKVLLEIAKEMPDSVGKLRRML 495 >ref|XP_021888710.1| protein RRP6-like 2 isoform X2 [Carica papaya] Length = 583 Score = 67.0 bits (162), Expect = 1e-07 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGEL 13 + + LC+WRDI+AR +DESTGY+LPN+ L+EIAK+MP+T G+L Sbjct: 135 LAIVSGLCEWRDIIARMEDESTGYILPNRTLLEIAKQMPTTAGKL 179 >ref|XP_021888709.1| protein RRP6-like 2 isoform X1 [Carica papaya] Length = 586 Score = 67.0 bits (162), Expect = 1e-07 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGEL 13 + + LC+WRDI+AR +DESTGY+LPN+ L+EIAK+MP+T G+L Sbjct: 138 LAIVSGLCEWRDIIARMEDESTGYILPNRTLLEIAKQMPTTAGKL 182 >gb|OMO67884.1| hypothetical protein CCACVL1_20240 [Corchorus capsularis] Length = 948 Score = 67.4 bits (163), Expect = 2e-07 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + LC+WRD++AR +DESTGYVLPNK L+EIAK+MP+T G+L +L Sbjct: 499 LAIVAGLCEWRDVIARAEDESTGYVLPNKVLLEIAKQMPTTAGKLRRLL 547 >gb|OMO70391.1| hypothetical protein COLO4_28619 [Corchorus olitorius] Length = 983 Score = 67.4 bits (163), Expect = 2e-07 Identities = 29/49 (59%), Positives = 40/49 (81%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + LC+WRD++AR +DESTGYVLPNK L+EIAK+MP+T G+L +L Sbjct: 535 LAIVAGLCEWRDVIARAEDESTGYVLPNKVLLEIAKQMPTTAGKLRRLL 583 >dbj|GAV88737.1| LOW QUALITY PROTEIN: HRDC domain-containing protein/DNA_pol_A_exo1 domain-containing protein, partial [Cephalotus follicularis] Length = 650 Score = 67.0 bits (162), Expect = 2e-07 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = -2 Query: 141 VKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 V LC+WRD+VAR +DESTGY+LPNK LIEIAK+MP T +L VL Sbjct: 253 VVAGLCEWRDVVARAEDESTGYILPNKTLIEIAKQMPVTANKLRRVL 299 >gb|EOY10516.1| Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain, putative isoform 2, partial [Theobroma cacao] gb|EOY10517.1| Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain, putative isoform 2, partial [Theobroma cacao] Length = 873 Score = 67.0 bits (162), Expect = 2e-07 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + ALC+WRDI+AR +DESTGYVLPNK L+EIAK+MP T +L +L Sbjct: 443 LAIVAALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLL 491 >ref|XP_007204663.2| protein RRP6-like 2 [Prunus persica] gb|ONH94321.1| hypothetical protein PRUPE_7G010800 [Prunus persica] Length = 919 Score = 67.0 bits (162), Expect = 2e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGEL 13 + + LC+WRD+VAR +DESTGY+LPNK L+EIAK+MPST +L Sbjct: 484 LAIVSGLCEWRDVVARAEDESTGYILPNKTLLEIAKQMPSTTSKL 528 >ref|XP_021281829.1| protein RRP6-like 2 [Herrania umbratica] Length = 920 Score = 67.0 bits (162), Expect = 2e-07 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + ALC+WRDI+AR +DESTGYVLPNK L+EIAK+MP T +L +L Sbjct: 490 LAIVAALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTTSKLRRLL 538 >ref|XP_007030013.2| PREDICTED: protein RRP6-like 2 [Theobroma cacao] Length = 920 Score = 67.0 bits (162), Expect = 2e-07 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + ALC+WRDI+AR +DESTGYVLPNK L+EIAK+MP T +L +L Sbjct: 490 LAIVAALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLL 538 >gb|EOY10515.1| Polynucleotidyl transferase, putative isoform 1 [Theobroma cacao] Length = 920 Score = 67.0 bits (162), Expect = 2e-07 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + + ALC+WRDI+AR +DESTGYVLPNK L+EIAK+MP T +L +L Sbjct: 490 LAIVAALCEWRDIIARAEDESTGYVLPNKTLLEIAKQMPVTASKLRRLL 538 >gb|KFK35633.1| hypothetical protein AALP_AA4G016400 [Arabis alpina] Length = 651 Score = 66.6 bits (161), Expect = 2e-07 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -2 Query: 129 LCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 LC+WRD++AR+ DESTGYVLPNK L+EIAK+MP +G+L +L Sbjct: 392 LCEWRDLIARSDDESTGYVLPNKTLLEIAKEMPINVGKLRRLL 434 >gb|KFK35634.1| hypothetical protein AALP_AA4G016400 [Arabis alpina] Length = 653 Score = 66.6 bits (161), Expect = 2e-07 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -2 Query: 129 LCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 LC+WRD++AR+ DESTGYVLPNK L+EIAK+MP +G+L +L Sbjct: 392 LCEWRDLIARSDDESTGYVLPNKTLLEIAKEMPINVGKLRRLL 434 >dbj|BAJ98461.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 524 Score = 66.2 bits (160), Expect = 2e-07 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + V AL QWRD +AR++DESTGYVLPNK LIEIAKKMP+T +L ++ Sbjct: 185 LAVVSALHQWRDYIARDQDESTGYVLPNKALIEIAKKMPTTTADLRRIV 233 >dbj|BAJ99123.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 592 Score = 66.2 bits (160), Expect = 3e-07 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -2 Query: 147 IIVKQALCQWRDIVARNKDESTGYVLPNKNLIEIAKKMPSTIGELSGVL 1 + V AL QWRD +AR++DESTGYVLPNK LIEIAKKMP+T +L ++ Sbjct: 253 LAVVSALHQWRDYIARDQDESTGYVLPNKALIEIAKKMPTTTADLRRIV 301