BLASTX nr result
ID: Chrysanthemum22_contig00013048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00013048 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG17073.1| putative RGS domain-containing protein [Helianthu... 60 2e-09 ref|XP_021998071.1| regulator of G-protein signaling 1 [Helianth... 62 8e-09 ref|XP_021976033.1| regulator of G-protein signaling 1-like [Hel... 60 4e-08 ref|XP_023734411.1| regulator of G-protein signaling 1 [Lactuca ... 58 2e-07 gb|PLY73322.1| hypothetical protein LSAT_8X150440 [Lactuca sativa] 58 2e-07 >gb|OTG17073.1| putative RGS domain-containing protein [Helianthus annuus] Length = 108 Score = 60.5 bits (145), Expect = 2e-09 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 362 SPRLSSVHCPDDPFYQDHISRDPPSHDAHGSY 267 S R SS+HCP DPFYQDHI RDPPSHD GSY Sbjct: 75 SLRPSSIHCPGDPFYQDHIPRDPPSHDGQGSY 106 >ref|XP_021998071.1| regulator of G-protein signaling 1 [Helianthus annuus] gb|OTG05302.1| putative G-protein coupled receptor [Helianthus annuus] Length = 464 Score = 62.4 bits (150), Expect = 8e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 365 FSPRLSSVHCPDDPFYQDHISRDPPSHDAHGSY 267 FSPRLSSVHCPDDPFYQ I RDPPS+D HGSY Sbjct: 432 FSPRLSSVHCPDDPFYQ--IPRDPPSNDGHGSY 462 >ref|XP_021976033.1| regulator of G-protein signaling 1-like [Helianthus annuus] Length = 509 Score = 60.5 bits (145), Expect = 4e-08 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -1 Query: 362 SPRLSSVHCPDDPFYQDHISRDPPSHDAHGSY 267 S R SS+HCP DPFYQDHI RDPPSHD GSY Sbjct: 476 SLRPSSIHCPGDPFYQDHIPRDPPSHDGQGSY 507 >ref|XP_023734411.1| regulator of G-protein signaling 1 [Lactuca sativa] Length = 461 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 365 FSPRLSSVHCPDDPFYQDHISRDPPSHDAH 276 FSPRLSSVHCPDDPFYQDH+SRDP + H Sbjct: 432 FSPRLSSVHCPDDPFYQDHMSRDPTTTHYH 461 >gb|PLY73322.1| hypothetical protein LSAT_8X150440 [Lactuca sativa] Length = 507 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 365 FSPRLSSVHCPDDPFYQDHISRDPPSHDAH 276 FSPRLSSVHCPDDPFYQDH+SRDP + H Sbjct: 478 FSPRLSSVHCPDDPFYQDHMSRDPTTTHYH 507