BLASTX nr result
ID: Chrysanthemum22_contig00012177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00012177 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH91571.1| Aminoacyl-tRNA synthetase, class 1a, anticodon-bi... 61 6e-08 ref|XP_022028934.1| isoleucine--tRNA ligase, chloroplastic/mitoc... 55 6e-06 >gb|KVH91571.1| Aminoacyl-tRNA synthetase, class 1a, anticodon-binding [Cynara cardunculus var. scolymus] Length = 1080 Score = 60.8 bits (146), Expect = 6e-08 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -2 Query: 166 CVIMFIVFTNLILQKAVHVLSLRNCSLFTKSSSFSIIDFRRCSSIELSSLFH 11 C I + + ++ K V VLS R+CS FTKSS FSIIDFRRCSS++LSSLFH Sbjct: 2 CTINWSGISLILSYKTVQVLSFRSCSSFTKSS-FSIIDFRRCSSMDLSSLFH 52 >ref|XP_022028934.1| isoleucine--tRNA ligase, chloroplastic/mitochondrial [Helianthus annuus] gb|OTG31919.1| putative tRNA synthetase class I (I, L, M and V) family protein [Helianthus annuus] Length = 1072 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -2 Query: 136 LILQKAVHVLSLRNCSLFTKSSSFSIIDFRRCSSIELSSLF 14 + +Q + V+SLR+CS F K+SSFS++DF+RCS+IELSSLF Sbjct: 1 MAMQTSHTVMSLRSCSSFRKTSSFSLVDFQRCSAIELSSLF 41