BLASTX nr result
ID: Chrysanthemum22_contig00011977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011977 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 73 1e-11 ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 61 1e-07 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 72.8 bits (177), Expect = 1e-11 Identities = 39/71 (54%), Positives = 49/71 (69%), Gaps = 4/71 (5%) Frame = -3 Query: 525 VSKLKMEPLHTRFELRTDSKYAA--C*LN--TERIKGRLINWQITLNQYELYIKYIKSED 358 + K +++ L TRF LRTDSKY A C N T+ GRLI WQ+ L Y+ Y++ IKSE+ Sbjct: 616 LEKWRIDLLQTRFLLRTDSKYFAGFCRYNIKTDYRNGRLIRWQLRLQAYQPYVELIKSEN 675 Query: 357 NSFADTLTREW 325 N FADTLTREW Sbjct: 676 NPFADTLTREW 686 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/69 (49%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = -3 Query: 519 KLKMEPLHTRFELRTDSKY----AAC*LNTERIKGRLINWQITLNQYELYIKYIKSEDNS 352 K K E L F LRTDS Y A L +GRL+ WQ+ QY ++YIK E NS Sbjct: 572 KWKAELLPKEFTLRTDSSYVTGFARHNLKANYNQGRLVRWQLEFLQYPARVEYIKGEKNS 631 Query: 351 FADTLTREW 325 ADTLTREW Sbjct: 632 LADTLTREW 640