BLASTX nr result
ID: Chrysanthemum22_contig00011647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011647 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99251.1| Calponin homology domain-containing protein [Cyna... 56 3e-06 >gb|KVH99251.1| Calponin homology domain-containing protein [Cynara cardunculus var. scolymus] Length = 904 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -3 Query: 419 QLRSGNA*VVISPVRMPRCNPTNSLRPDANQRHVDENKPSE 297 QLRSG ISPV MPR N TN+LRP+ANQRHVD+NK E Sbjct: 664 QLRSGMTRGAISPVHMPRHNLTNNLRPEANQRHVDDNKLPE 704