BLASTX nr result
ID: Chrysanthemum22_contig00011494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011494 (1296 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ELU12889.1| hypothetical protein CAPTEDRAFT_39468, partial [C... 57 2e-06 >gb|ELU12889.1| hypothetical protein CAPTEDRAFT_39468, partial [Capitella teleta] Length = 125 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 8/67 (11%) Frame = +3 Query: 678 SSSCST*YIYTRFFSEANAGKRVP-SIFIDLESTVIYDVKS-------DPKKLIPGKENV 833 S++C T ++ FFSE AGK VP ++F+DLE TV+ +V+S P++LI GKE+ Sbjct: 40 SANCPTDDSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRSGAYRQLFHPEQLITGKEDA 99 Query: 834 ANYFARG 854 AN +ARG Sbjct: 100 ANNYARG 106