BLASTX nr result
ID: Chrysanthemum22_contig00011395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011395 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022015750.1| protein phosphatase 2C and cyclic nucleotide... 77 8e-14 ref|XP_022015749.1| protein phosphatase 2C and cyclic nucleotide... 77 8e-14 ref|XP_023756758.1| protein phosphatase 2C and cyclic nucleotide... 70 2e-11 ref|XP_011048354.1| PREDICTED: protein phosphatase 2C and cyclic... 56 3e-06 ref|XP_020536383.1| protein phosphatase 2C and cyclic nucleotide... 55 7e-06 ref|XP_021663106.1| protein phosphatase 2C and cyclic nucleotide... 55 7e-06 ref|XP_012076755.1| protein phosphatase 2C and cyclic nucleotide... 55 7e-06 >ref|XP_022015750.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X2 [Helianthus annuus] gb|OTF91159.1| putative protein serine/threonine phosphatase [Helianthus annuus] Length = 1070 Score = 77.4 bits (189), Expect = 8e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 GSCT PQEIL+RIDQYLE+RP++ +AP V +DVDELNTPEWL+ W Sbjct: 1024 GSCTVPQEILTRIDQYLETRPADISAPDVSTNDDVDELNTPEWLEDW 1070 >ref|XP_022015749.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X1 [Helianthus annuus] Length = 1071 Score = 77.4 bits (189), Expect = 8e-14 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 GSCT PQEIL+RIDQYLE+RP++ +AP V +DVDELNTPEWL+ W Sbjct: 1025 GSCTVPQEILTRIDQYLETRPADISAPDVSTNDDVDELNTPEWLEDW 1071 >ref|XP_023756758.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Lactuca sativa] ref|XP_023756759.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Lactuca sativa] ref|XP_023756760.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Lactuca sativa] ref|XP_023756761.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Lactuca sativa] gb|PLY90717.1| hypothetical protein LSAT_8X96380 [Lactuca sativa] Length = 1070 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/49 (63%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSE--TTAPVVLATEDVDELNTPEWLDGW 273 G+CTAPQEI+SRIDQYLE+RP++ + + +L ED+DELNTPEWL W Sbjct: 1022 GTCTAPQEIISRIDQYLENRPTDNLSVSVSILPNEDIDELNTPEWLHDW 1070 >ref|XP_011048354.1| PREDICTED: protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Populus euphratica] Length = 1082 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/46 (52%), Positives = 32/46 (69%) Frame = -1 Query: 410 SCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 S P+EI SR+ Q+LES E TAP+ ++D+D+LN PEWLD W Sbjct: 1037 SFPVPREITSRVAQHLESHSVECTAPLTSQSQDLDDLNAPEWLDDW 1082 >ref|XP_020536383.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X2 [Jatropha curcas] Length = 973 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/47 (48%), Positives = 28/47 (59%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 GS P +I SR+ QYLES + T P D+D+LN PEWLD W Sbjct: 927 GSYPVPHDITSRVTQYLESHHEDCTIPPTSPARDIDDLNVPEWLDDW 973 >ref|XP_021663106.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Hevea brasiliensis] ref|XP_021663107.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein [Hevea brasiliensis] Length = 1094 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 GS P +I RI Q+LES P + T P+ + +VD+LN PEWLD W Sbjct: 1048 GSFHVPHDITFRITQHLESHPDDCTVPLASPSREVDDLNVPEWLDDW 1094 >ref|XP_012076755.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X1 [Jatropha curcas] ref|XP_012076756.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X1 [Jatropha curcas] ref|XP_012076757.1| protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein isoform X1 [Jatropha curcas] gb|KDP33717.1| hypothetical protein JCGZ_07288 [Jatropha curcas] Length = 1094 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/47 (48%), Positives = 28/47 (59%) Frame = -1 Query: 413 GSCTAPQEILSRIDQYLESRPSETTAPVVLATEDVDELNTPEWLDGW 273 GS P +I SR+ QYLES + T P D+D+LN PEWLD W Sbjct: 1048 GSYPVPHDITSRVTQYLESHHEDCTIPPTSPARDIDDLNVPEWLDDW 1094