BLASTX nr result
ID: Chrysanthemum22_contig00011137
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011137 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023753203.1| guanine nucleotide-binding protein-like NSN1... 59 5e-07 gb|KVI03821.1| GTP binding domain-containing protein, partial [C... 59 6e-07 ref|XP_021975732.1| guanine nucleotide-binding protein-like NSN1... 57 2e-06 ref|XP_010684929.1| PREDICTED: guanine nucleotide-binding protei... 55 7e-06 ref|XP_015088013.1| PREDICTED: guanine nucleotide-binding protei... 55 1e-05 ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] >... 55 1e-05 ref|XP_009772077.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucl... 55 1e-05 >ref|XP_023753203.1| guanine nucleotide-binding protein-like NSN1 [Lactuca sativa] gb|PLY93509.1| hypothetical protein LSAT_5X179901 [Lactuca sativa] Length = 591 Score = 58.9 bits (141), Expect = 5e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 V +ILKLC AEM VT YKIP F V+DFLS +A VR KL KG V++ Sbjct: 348 VKEILKLCPAEMLVTLYKIPAFDSVDDFLSKVATVRGKLKKGGVMD 393 >gb|KVI03821.1| GTP binding domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 617 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLE 12 V +ILKLC AEM VT YKIP+F V+DFLS +A +R KL KG +++ Sbjct: 351 VKEILKLCPAEMLVTLYKIPIFNSVDDFLSKVATIRGKLKKGGLVD 396 >ref|XP_021975732.1| guanine nucleotide-binding protein-like NSN1 [Helianthus annuus] gb|OTG37053.1| putative guanine nucleotide-binding protein [Helianthus annuus] Length = 585 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC AE VT YKIP F +DFLS +A VR KL KG VL+ D Sbjct: 347 VKEILKLCPAETLVTLYKIPTFNSDDDFLSKVATVRGKLKKGGVLDTD 394 >ref|XP_010684929.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Beta vulgaris subsp. vulgaris] gb|KMT05690.1| hypothetical protein BVRB_7g166980 [Beta vulgaris subsp. vulgaris] Length = 596 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -2 Query: 155 AKVMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 A V +ILKLC A++ VT YK+P F V++FL N+A VR +L KG V++ D Sbjct: 342 APVKEILKLCPAQVLVTLYKVPSFDTVDEFLQNVASVRGRLKKGGVVDVD 391 >ref|XP_015088013.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Solanum pennellii] Length = 609 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC M VT YKIP F V+DFL +A VR KL KG +++ D Sbjct: 355 VKEILKLCPERMLVTIYKIPTFDSVDDFLQKVAMVRGKLKKGGIVDTD 402 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC M VT YKIP F V+DFL +A VR KL KG +++ D Sbjct: 355 VKEILKLCPERMLVTIYKIPTFDSVDDFLQKVAMVRGKLKKGGIVDTD 402 >ref|XP_009772077.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein-like 3 homolog [Nicotiana sylvestris] Length = 610 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/48 (56%), Positives = 33/48 (68%) Frame = -2 Query: 149 VMKILKLCSAEMFVT*YKIPVFGYVEDFLSNLAKVRSKLNKGSVLEND 6 V +ILKLC A M VT YK+P F V+DFL +A VR KL KG V++ D Sbjct: 348 VKEILKLCPARMLVTIYKVPSFDSVDDFLQKVATVRGKLKKGGVVDID 395