BLASTX nr result
ID: Chrysanthemum22_contig00011134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00011134 (1212 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022021969.1| 26S proteasome non-ATPase regulatory subunit... 74 1e-11 gb|KVI11715.1| PDZ domain-containing protein [Cynara cardunculus... 70 4e-10 emb|CDP10234.1| unnamed protein product [Coffea canephora] 66 1e-09 ref|XP_012839865.1| PREDICTED: 26S proteasome non-ATPase regulat... 68 2e-09 ref|XP_021614874.1| 26S proteasome non-ATPase regulatory subunit... 68 3e-09 ref|XP_021672060.1| 26S proteasome non-ATPase regulatory subunit... 68 3e-09 ref|XP_021857671.1| 26S proteasome non-ATPase regulatory subunit... 65 1e-08 ref|XP_021857670.1| 26S proteasome non-ATPase regulatory subunit... 65 1e-08 ref|XP_010275822.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 2e-08 ref|XP_017422123.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 2e-08 ref|XP_014496174.1| probable 26S proteasome regulatory subunit p... 65 2e-08 ref|XP_010942090.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 2e-08 gb|KOM40210.1| hypothetical protein LR48_Vigan04g040800 [Vigna a... 65 2e-08 gb|EPS60916.1| hypothetical protein M569_13886 [Genlisea aurea] 65 2e-08 ref|XP_008785848.1| PREDICTED: 26S proteasome non-ATPase regulat... 64 2e-08 ref|XP_012071506.1| 26S proteasome non-ATPase regulatory subunit... 65 2e-08 ref|XP_008367746.1| PREDICTED: 26S proteasome non-ATPase regulat... 65 3e-08 ref|XP_011083972.1| 26S proteasome non-ATPase regulatory subunit... 65 3e-08 gb|KZV40656.1| 26S proteasome non-ATPase regulatory subunit 9-li... 65 3e-08 ref|XP_002309347.1| 26S proteasome regulatory subunit family pro... 64 3e-08 >ref|XP_022021969.1| 26S proteasome non-ATPase regulatory subunit 9 [Helianthus annuus] gb|OTF86587.1| putative 26S proteasome regulatory subunit, putative [Helianthus annuus] Length = 211 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRADR+RLAGLR+DHKDITEKISKNIE Sbjct: 48 GFPRSDIDIPVVRADRHRLAGLRNDHKDITEKISKNIE 85 >gb|KVI11715.1| PDZ domain-containing protein [Cynara cardunculus var. scolymus] Length = 239 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRADRNRLAGLR+DH DITEKI +NIE Sbjct: 44 GFPRSDIDIPLVRADRNRLAGLRNDHTDITEKIGQNIE 81 >emb|CDP10234.1| unnamed protein product [Coffea canephora] Length = 127 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR+DIDIPAVRA+R+RLA LR+DHKDITEKI++NI+ Sbjct: 47 GFPRADIDIPAVRAERHRLAELRNDHKDITEKINQNIQ 84 >ref|XP_012839865.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9 [Erythranthe guttata] gb|EYU35325.1| hypothetical protein MIMGU_mgv1a013504mg [Erythranthe guttata] Length = 218 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRADR+RLA LRS+HKDITEKI++NIE Sbjct: 48 GFPRSDIDIPTVRADRHRLAELRSNHKDITEKINQNIE 85 >ref|XP_021614874.1| 26S proteasome non-ATPase regulatory subunit 9 [Manihot esculenta] gb|OAY46866.1| hypothetical protein MANES_06G034000 [Manihot esculenta] Length = 230 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNI 6 GFPR+DIDIPAVRA+RNRLA LRSDHK+ITEKIS+NI Sbjct: 48 GFPRADIDIPAVRAERNRLAVLRSDHKEITEKISENI 84 >ref|XP_021672060.1| 26S proteasome non-ATPase regulatory subunit 9 [Hevea brasiliensis] Length = 231 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNI 6 GFPR+DIDIPAVRA+RNRLA LRSDHK+ITEKIS+NI Sbjct: 48 GFPRADIDIPAVRAERNRLAVLRSDHKEITEKISENI 84 >ref|XP_021857671.1| 26S proteasome non-ATPase regulatory subunit 9 isoform X2 [Spinacia oleracea] Length = 203 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR+DIDIPAVRADR RLA L+ DHKD+TEKIS+NI+ Sbjct: 48 GFPRTDIDIPAVRADRQRLAELKIDHKDLTEKISQNIQ 85 >ref|XP_021857670.1| 26S proteasome non-ATPase regulatory subunit 9 isoform X1 [Spinacia oleracea] gb|KNA25315.1| hypothetical protein SOVF_007660 [Spinacia oleracea] Length = 208 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR+DIDIPAVRADR RLA L+ DHKD+TEKIS+NI+ Sbjct: 48 GFPRTDIDIPAVRADRQRLAELKIDHKDLTEKISQNIQ 85 >ref|XP_010275822.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9 [Nelumbo nucifera] Length = 225 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIPAVRADR+RLA L +DHKDIT+KI++N++ Sbjct: 48 GFPRSDIDIPAVRADRHRLADLHNDHKDITDKINENLQ 85 >ref|XP_017422123.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9 [Vigna angularis] dbj|BAT79725.1| hypothetical protein VIGAN_02265000 [Vigna angularis var. angularis] Length = 230 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRA+R RLA LR+DHK+ITEKI+KNI+ Sbjct: 48 GFPRSDIDIPVVRAERRRLAELRNDHKEITEKINKNIQ 85 >ref|XP_014496174.1| probable 26S proteasome regulatory subunit p27 [Vigna radiata var. radiata] Length = 230 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIPAVRA+R RLA LR+DHK+ITEKI++NI+ Sbjct: 48 GFPRSDIDIPAVRAERRRLAELRNDHKEITEKINQNIQ 85 >ref|XP_010942090.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9 [Elaeis guineensis] Length = 213 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIPA+R+ R RLA LR+DHKDITEKI KN++ Sbjct: 48 GFPRSDIDIPAIRSQRARLAALRNDHKDITEKIEKNLQ 85 >gb|KOM40210.1| hypothetical protein LR48_Vigan04g040800 [Vigna angularis] Length = 240 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRA+R RLA LR+DHK+ITEKI+KNI+ Sbjct: 48 GFPRSDIDIPVVRAERRRLAELRNDHKEITEKINKNIQ 85 >gb|EPS60916.1| hypothetical protein M569_13886 [Genlisea aurea] Length = 208 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIPAVRADR RLA LR DH+D+TEK+++NI+ Sbjct: 48 GFPRSDIDIPAVRADRRRLAELRYDHRDVTEKMNQNIQ 85 >ref|XP_008785848.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform X2 [Phoenix dactylifera] ref|XP_008803715.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like isoform X2 [Phoenix dactylifera] Length = 175 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIPA+R+ R RLA LR+DHKDIT+KI KN++ Sbjct: 48 GFPRSDIDIPAIRSQRARLAALRNDHKDITDKIEKNLQ 85 >ref|XP_012071506.1| 26S proteasome non-ATPase regulatory subunit 9 [Jatropha curcas] gb|KDP38678.1| hypothetical protein JCGZ_04031 [Jatropha curcas] Length = 232 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR+DIDIP VRA+RNRLA LRSDHK+ITEKI+ NI+ Sbjct: 48 GFPRTDIDIPVVRAERNRLAVLRSDHKEITEKINANIQ 85 >ref|XP_008367746.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 9-like [Malus domestica] Length = 219 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR DIDIPAVRA+R RLA LR+DHK+ITEK+++NIE Sbjct: 48 GFPREDIDIPAVRAERRRLAELRNDHKEITEKLNRNIE 85 >ref|XP_011083972.1| 26S proteasome non-ATPase regulatory subunit 9 [Sesamum indicum] ref|XP_020550888.1| 26S proteasome non-ATPase regulatory subunit 9 [Sesamum indicum] ref|XP_020550889.1| 26S proteasome non-ATPase regulatory subunit 9 [Sesamum indicum] Length = 223 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR++IDIP VRADR+RLA LR+DHKDITEKI++NI+ Sbjct: 48 GFPRAEIDIPTVRADRHRLAELRNDHKDITEKINQNIQ 85 >gb|KZV40656.1| 26S proteasome non-ATPase regulatory subunit 9-like [Dorcoceras hygrometricum] Length = 224 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPR+DIDIP VRADR RLA LR+DHKDIT+KI++NI+ Sbjct: 49 GFPRADIDIPTVRADRRRLAELRNDHKDITDKINQNIQ 86 >ref|XP_002309347.1| 26S proteasome regulatory subunit family protein [Populus trichocarpa] gb|PNT32346.1| hypothetical protein POPTR_006G184600v3 [Populus trichocarpa] Length = 211 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -2 Query: 116 GFPRSDIDIPAVRADRNRLAGLRSDHKDITEKISKNIE 3 GFPRSDIDIP VRA+R+RLA LR+DHK+ITEKI++NI+ Sbjct: 48 GFPRSDIDIPVVRAERHRLAELRNDHKEITEKINENIQ 85