BLASTX nr result
ID: Chrysanthemum22_contig00010957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010957 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI03978.1| Protein of unknown function DUF926 [Cynara cardun... 54 9e-06 >gb|KVI03978.1| Protein of unknown function DUF926 [Cynara cardunculus var. scolymus] Length = 550 Score = 53.5 bits (127), Expect = 9e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = -2 Query: 166 DSASEKNSGSENDAKGKVNMDDAEKPVSESELLAIKEMIESRKKAAVSEDDEL 8 +SAS++NS END K +DDAEK +SELL KEMIESRKK A+ ++ E+ Sbjct: 364 NSASDENSDPENDIN-KPKVDDAEKTEVDSELLMFKEMIESRKKPALDDEPEV 415