BLASTX nr result
ID: Chrysanthemum22_contig00010726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010726 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATL16948.1| ribosomal protein L14 (chloroplast) [Chrysanthemu... 56 3e-07 gb|APU88533.1| ribosomal protein L14 (chloroplast) [Tylosema esc... 56 3e-07 gb|AEX99551.1| ribosomal protein L14 (chloroplast) [Chrysanthemu... 56 3e-07 ref|YP_007353803.1| ribosomal protein L14 (chloroplast) [Chrysan... 56 3e-07 gb|AER53340.1| ribosomal protein L14, partial (plastid) [Asclepi... 54 3e-07 ref|YP_009435525.1| ribosomal protein L14 (plastid) [Lobelia son... 55 5e-07 ref|YP_009436850.1| ribosomal protein L14 (plastid) [Cyphia schl... 55 5e-07 ref|YP_009406696.1| ribosomal protein L14 (plastid) [Sclerotheca... 55 5e-07 ref|YP_009402909.1| ribosomal protein L14 (plastid) [Sclerotheca... 55 5e-07 ref|YP_009160623.1| ribosomal protein L14 (chloroplast) [Sciaphi... 55 5e-07 gb|ASA38143.1| ribosomal protein L14 (plastid) [Lobelia sp. 1 EB... 55 8e-07 gb|OTF86784.1| putative ribosomal protein L14b/L23e [Helianthus ... 55 8e-07 gb|OTF84456.1| putative 50S ribosomal protein L14 protein [Helia... 54 1e-06 gb|OTF96146.1| putative ribosomal protein L14b/L23e [Helianthus ... 54 1e-06 gb|ONK55029.1| uncharacterized protein A4U43_UnF8380 [Asparagus ... 54 1e-06 ref|YP_009434815.1| ribosomal protein L14 (plastid) [Lobelia gal... 55 1e-06 ref|YP_009437054.1| ribosomal protein L14 (plastid) [Grammatothe... 55 1e-06 ref|YP_009436061.1| ribosomal protein L14 (plastid) [Lobelia phy... 55 1e-06 ref|YP_009435704.1| ribosomal protein L14 (plastid) [Lobelia the... 55 1e-06 ref|YP_009435261.1| ribosomal protein L14 (plastid) [Lobelia mal... 55 1e-06 >gb|ATL16948.1| ribosomal protein L14 (chloroplast) [Chrysanthemum zawadskii subsp. coreanum] Length = 122 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D R GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQERNPKGTRVFGAIARELRQFNFTKIVSLAPEVL 122 >gb|APU88533.1| ribosomal protein L14 (chloroplast) [Tylosema esculentum] Length = 122 Score = 56.2 bits (134), Expect = 3e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D R GTR+FGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQKRNPKGTRIFGAIARELRQFNFTKIVSLAPEVL 122 >gb|AEX99551.1| ribosomal protein L14 (chloroplast) [Chrysanthemum indicum] Length = 122 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D R GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQERNPKGTRVFGAIARELRQFNFTKIVSLAPEVL 122 >ref|YP_007353803.1| ribosomal protein L14 (chloroplast) [Chrysanthemum x morifolium] ref|YP_007474766.1| ribosomal protein L14 (chloroplast) [Chrysanthemum indicum] gb|AEX99315.1| ribosomal protein L14 (chloroplast) [Chrysanthemum indicum] gb|AFA45312.1| ribosomal protein L14 (chloroplast) [Chrysanthemum x morifolium] gb|ATL16885.1| ribosomal protein L14 (chloroplast) [Chrysanthemum zawadskii var. latilobum] gb|AVI25946.1| ribosomal protein L14 (chloroplast) [Chrysanthemum boreale] Length = 122 Score = 56.2 bits (134), Expect = 3e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D R GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQERNPKGTRVFGAIARELRQFNFTKIVSLAPEVL 122 >gb|AER53340.1| ribosomal protein L14, partial (plastid) [Asclepias subulata] Length = 41 Score = 53.9 bits (128), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTR+FGAIA ELRQFNFTKIVSLAPEVL Sbjct: 14 GTRIFGAIARELRQFNFTKIVSLAPEVL 41 >ref|YP_009435525.1| ribosomal protein L14 (plastid) [Lobelia sonderiana] gb|ATG25526.1| ribosomal protein L14 (plastid) [Lobelia sonderiana] Length = 122 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQAGNPKGTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009436850.1| ribosomal protein L14 (plastid) [Cyphia schlechteri] ref|YP_009436893.1| ribosomal protein L14 (plastid) [Cyphia schlechteri] gb|ATG27225.1| ribosomal protein L14 (plastid) [Cyphia schlechteri] gb|ATG27270.1| ribosomal protein L14 (plastid) [Cyphia schlechteri] Length = 122 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQAGNPKGTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009406696.1| ribosomal protein L14 (plastid) [Sclerotheca viridiflora] gb|ASA39216.1| ribosomal protein L14 (plastid) [Sclerotheca viridiflora] Length = 122 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQAGNPKGTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009402909.1| ribosomal protein L14 (plastid) [Sclerotheca longistigmata] gb|ASA34101.1| ribosomal protein L14 (plastid) [Sclerotheca longistigmata] Length = 122 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQAGNPKGTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009160623.1| ribosomal protein L14 (chloroplast) [Sciaphila densiflora] gb|AKR17953.1| ribosomal protein L14 (chloroplast) [Sciaphila densiflora] Length = 122 Score = 55.5 bits (132), Expect = 5e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 ++ D R GTRVFGAIA ELRQ NFTKIVSLAPEVL Sbjct: 85 IVIDQERNLKGTRVFGAIAQELRQLNFTKIVSLAPEVL 122 >gb|ASA38143.1| ribosomal protein L14 (plastid) [Lobelia sp. 1 EBK-2017] Length = 122 Score = 55.1 bits (131), Expect = 8e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKI+SLAPEVL Sbjct: 85 VVIDQAGNPKGTRVFGAIAEELRQFNFTKIISLAPEVL 122 >gb|OTF86784.1| putative ribosomal protein L14b/L23e [Helianthus annuus] Length = 122 Score = 55.1 bits (131), Expect = 8e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 174 VITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 V+ D GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 85 VVIDQEGNLKGTRVFGAIARELRQFNFTKIVSLAPEVL 122 >gb|OTF84456.1| putative 50S ribosomal protein L14 protein [Helianthus annuus] Length = 102 Score = 54.3 bits (129), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 75 GTRVFGAIARELRQFNFTKIVSLAPEVL 102 >gb|OTF96146.1| putative ribosomal protein L14b/L23e [Helianthus annuus] Length = 103 Score = 54.3 bits (129), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 76 GTRVFGAIARELRQFNFTKIVSLAPEVL 103 >gb|ONK55029.1| uncharacterized protein A4U43_UnF8380 [Asparagus officinalis] Length = 103 Score = 54.3 bits (129), Expect = 1e-06 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 8/60 (13%) Frame = +3 Query: 132 VRSNVPLQCTIGRLV--------ITDYCRCFSGTRVFGAIAPELRQFNFTKIVSLAPEVL 287 VR+ L+C G ++ + D R GTRVFGAIA ELRQ NFTKIVSLAPEVL Sbjct: 44 VRTCKELKCDNGMIIRYDDNAAIVIDQERNPKGTRVFGAIARELRQLNFTKIVSLAPEVL 103 >ref|YP_009434815.1| ribosomal protein L14 (plastid) [Lobelia galpinii] gb|ATG24721.1| ribosomal protein L14 (plastid) [Lobelia galpinii] Length = 122 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 95 GTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009437054.1| ribosomal protein L14 (plastid) [Grammatotheca bergiana] gb|ATG27429.1| ribosomal protein L14 (plastid) [Grammatotheca bergiana] Length = 122 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 95 GTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009436061.1| ribosomal protein L14 (plastid) [Lobelia physaloides] gb|ATG26238.1| ribosomal protein L14 (plastid) [Lobelia physaloides] Length = 122 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 95 GTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009435704.1| ribosomal protein L14 (plastid) [Lobelia thermalis] gb|ATG25705.1| ribosomal protein L14 (plastid) [Lobelia thermalis] Length = 122 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 95 GTRVFGAIAEELRQFNFTKIVSLAPEVL 122 >ref|YP_009435261.1| ribosomal protein L14 (plastid) [Lobelia malowensis] gb|ATG25262.1| ribosomal protein L14 (plastid) [Lobelia malowensis] Length = 122 Score = 54.7 bits (130), Expect = 1e-06 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 204 GTRVFGAIAPELRQFNFTKIVSLAPEVL 287 GTRVFGAIA ELRQFNFTKIVSLAPEVL Sbjct: 95 GTRVFGAIAEELRQFNFTKIVSLAPEVL 122