BLASTX nr result
ID: Chrysanthemum22_contig00010549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010549 (678 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88056.1| Ubiquitin-conjugating enzyme, E2 [Cynara carduncu... 63 1e-07 >gb|KVH88056.1| Ubiquitin-conjugating enzyme, E2 [Cynara cardunculus var. scolymus] Length = 1015 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 9/60 (15%) Frame = -3 Query: 238 MDSKVDSDGLEDKEHVNNQS---------RLPGTVSYIYRDDVVRSKNDGKIGLVTEVAG 86 M++K+ SD ED EH N+ R PG +SYIYR DVVRSK++GK G+VTEVAG Sbjct: 1 METKLHSDAHEDTEHYPNEGSNVKIDENGRRPGAISYIYRQDVVRSKSEGKTGIVTEVAG 60