BLASTX nr result
ID: Chrysanthemum22_contig00010460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010460 (591 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021977680.1| cyclin-dependent kinase F-4-like isoform X1 ... 42 2e-06 ref|XP_021977681.1| cyclin-dependent kinase F-4-like isoform X2 ... 42 2e-06 >ref|XP_021977680.1| cyclin-dependent kinase F-4-like isoform X1 [Helianthus annuus] Length = 444 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 195 NYTTGYSVFLPNVKPANNVISSVKVPA 115 NY GYS FLPNVKPA NV S KVPA Sbjct: 319 NYAMGYSGFLPNVKPAGNVNSYAKVPA 345 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -3 Query: 109 VRHEMEVNHQSGVTNAILYQTTAREPKYQPIGKYNT 2 V + E+NHQ GV + T+R+PKYQP KYNT Sbjct: 351 VHRKPEMNHQGGVNYE---KATSRQPKYQPTVKYNT 383 >ref|XP_021977681.1| cyclin-dependent kinase F-4-like isoform X2 [Helianthus annuus] gb|OTG18769.1| putative serine/threonine/dual specificity protein kinase, catalytic domain-containing protein [Helianthus annuus] Length = 441 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -1 Query: 195 NYTTGYSVFLPNVKPANNVISSVKVPA 115 NY GYS FLPNVKPA NV S KVPA Sbjct: 316 NYAMGYSGFLPNVKPAGNVNSYAKVPA 342 Score = 37.4 bits (85), Expect(2) = 2e-06 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -3 Query: 109 VRHEMEVNHQSGVTNAILYQTTAREPKYQPIGKYNT 2 V + E+NHQ GV + T+R+PKYQP KYNT Sbjct: 348 VHRKPEMNHQGGVNYE---KATSRQPKYQPTVKYNT 380