BLASTX nr result
ID: Chrysanthemum22_contig00010398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010398 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021989874.1| (R)-mandelonitrile lyase-like [Helianthus an... 57 4e-06 >ref|XP_021989874.1| (R)-mandelonitrile lyase-like [Helianthus annuus] gb|OTG12615.1| putative glucose-methanol-choline oxidoreductase, FAD/NAD(P)-binding domain protein [Helianthus annuus] Length = 548 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 273 VLGVGFLQVIQGSVSSISPGTNPEYTVLILGRHMGSK 383 V+GVG L+VI GSV SISPGTNP+ T+L+LGRHMG K Sbjct: 501 VIGVGSLRVIDGSVFSISPGTNPQATLLMLGRHMGLK 537