BLASTX nr result
ID: Chrysanthemum22_contig00010312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010312 (827 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022030180.1| vacuolar protein sorting-associated protein ... 93 1e-17 gb|OTG33097.1| putative vps53-like protein [Helianthus annuus] 93 1e-17 gb|PPR96551.1| hypothetical protein GOBAR_AA24104 [Gossypium bar... 87 5e-17 gb|KGN54961.1| hypothetical protein Csa_4G617290 [Cucumis sativus] 86 2e-16 gb|PLY80382.1| hypothetical protein LSAT_3X133361 [Lactuca sativa] 88 8e-16 ref|XP_023770392.1| vacuolar protein sorting-associated protein ... 88 9e-16 gb|KDO54004.1| hypothetical protein CISIN_1g0191322mg, partial [... 84 1e-15 gb|KJB25403.1| hypothetical protein B456_004G190000 [Gossypium r... 87 2e-15 gb|PPD89091.1| hypothetical protein GOBAR_DD14014 [Gossypium bar... 87 2e-15 ref|XP_022718168.1| vacuolar protein sorting-associated protein ... 87 2e-15 gb|OMP08173.1| hypothetical protein COLO4_06714 [Corchorus olito... 87 2e-15 ref|XP_012475775.1| PREDICTED: vacuolar protein sorting-associat... 87 2e-15 ref|XP_015959168.1| vacuolar protein sorting-associated protein ... 87 2e-15 dbj|GAV83547.1| Vps53_N domain-containing protein [Cephalotus fo... 87 2e-15 ref|XP_022718159.1| vacuolar protein sorting-associated protein ... 87 2e-15 gb|OMO91687.1| hypothetical protein CCACVL1_07051 [Corchorus cap... 87 2e-15 ref|XP_016705483.1| PREDICTED: vacuolar protein sorting-associat... 87 2e-15 ref|XP_016665827.1| PREDICTED: vacuolar protein sorting-associat... 87 2e-15 ref|XP_012475771.1| PREDICTED: vacuolar protein sorting-associat... 87 2e-15 ref|XP_017626725.1| PREDICTED: vacuolar protein sorting-associat... 87 2e-15 >ref|XP_022030180.1| vacuolar protein sorting-associated protein 53 A-like [Helianthus annuus] Length = 815 Score = 93.2 bits (230), Expect = 1e-17 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQTSGA GYAKFVSREMSKAE+LLKVILSPIDSVADTYGAL+ Sbjct: 654 LLDIPSLGRQTSGAAGYAKFVSREMSKAEALLKVILSPIDSVADTYGALL 703 >gb|OTG33097.1| putative vps53-like protein [Helianthus annuus] Length = 818 Score = 93.2 bits (230), Expect = 1e-17 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQTSGA GYAKFVSREMSKAE+LLKVILSPIDSVADTYGAL+ Sbjct: 657 LLDIPSLGRQTSGAAGYAKFVSREMSKAEALLKVILSPIDSVADTYGALL 706 >gb|PPR96551.1| hypothetical protein GOBAR_AA24104 [Gossypium barbadense] Length = 192 Score = 87.0 bits (214), Expect = 5e-17 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 27 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 76 >gb|KGN54961.1| hypothetical protein Csa_4G617290 [Cucumis sativus] Length = 240 Score = 86.3 bits (212), Expect = 2e-16 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQTSGA Y+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 77 LLDIPSLGRQTSGAASYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 126 >gb|PLY80382.1| hypothetical protein LSAT_3X133361 [Lactuca sativa] Length = 663 Score = 87.8 bits (216), Expect = 8e-16 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQ GA GY+KFVSREMSKAE+LLKVILSPIDSVADTYGAL+ Sbjct: 499 LLDIPSLGRQAIGAAGYSKFVSREMSKAEALLKVILSPIDSVADTYGALL 548 >ref|XP_023770392.1| vacuolar protein sorting-associated protein 53 A [Lactuca sativa] Length = 825 Score = 87.8 bits (216), Expect = 9e-16 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQ GA GY+KFVSREMSKAE+LLKVILSPIDSVADTYGAL+ Sbjct: 661 LLDIPSLGRQAIGAAGYSKFVSREMSKAEALLKVILSPIDSVADTYGALL 710 >gb|KDO54004.1| hypothetical protein CISIN_1g0191322mg, partial [Citrus sinensis] gb|KDO54005.1| hypothetical protein CISIN_1g0191322mg, partial [Citrus sinensis] Length = 200 Score = 83.6 bits (205), Expect = 1e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LLDIPSLGRQTS A Y KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 38 LLDIPSLGRQTSNAASYTKFVSREMSKAEALLKVILSPVDSVADTYRALL 87 >gb|KJB25403.1| hypothetical protein B456_004G190000 [Gossypium raimondii] Length = 732 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708 >gb|PPD89091.1| hypothetical protein GOBAR_DD14014 [Gossypium barbadense] Length = 797 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 632 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 681 >ref|XP_022718168.1| vacuolar protein sorting-associated protein 53 A-like isoform X3 [Durio zibethinus] Length = 802 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 637 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 686 >gb|OMP08173.1| hypothetical protein COLO4_06714 [Corchorus olitorius] Length = 804 Score = 87.0 bits (214), Expect = 2e-15 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY KFVSREMSKAE+LLKVILSPIDSVADTY AL+ Sbjct: 639 LLEIPSLGRQTSGAAGYTKFVSREMSKAEALLKVILSPIDSVADTYRALL 688 >ref|XP_012475775.1| PREDICTED: vacuolar protein sorting-associated protein 53 A isoform X2 [Gossypium raimondii] Length = 806 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 641 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 690 >ref|XP_015959168.1| vacuolar protein sorting-associated protein 53 A isoform X1 [Arachis duranensis] ref|XP_016197645.1| vacuolar protein sorting-associated protein 53 A [Arachis ipaensis] Length = 819 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 660 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 709 >dbj|GAV83547.1| Vps53_N domain-containing protein [Cephalotus follicularis] Length = 822 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 660 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 709 >ref|XP_022718159.1| vacuolar protein sorting-associated protein 53 A-like isoform X1 [Durio zibethinus] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708 >gb|OMO91687.1| hypothetical protein CCACVL1_07051 [Corchorus capsularis] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY KFVSREMSKAE+LLKVILSPIDSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYTKFVSREMSKAEALLKVILSPIDSVADTYRALL 708 >ref|XP_016705483.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] ref|XP_016705484.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] ref|XP_016705485.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708 >ref|XP_016665827.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] ref|XP_016665828.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] ref|XP_016665830.1| PREDICTED: vacuolar protein sorting-associated protein 53 A-like [Gossypium hirsutum] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708 >ref|XP_012475771.1| PREDICTED: vacuolar protein sorting-associated protein 53 A isoform X1 [Gossypium raimondii] ref|XP_012475772.1| PREDICTED: vacuolar protein sorting-associated protein 53 A isoform X1 [Gossypium raimondii] ref|XP_012475774.1| PREDICTED: vacuolar protein sorting-associated protein 53 A isoform X1 [Gossypium raimondii] gb|KJB25401.1| hypothetical protein B456_004G190000 [Gossypium raimondii] gb|KJB25404.1| hypothetical protein B456_004G190000 [Gossypium raimondii] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708 >ref|XP_017626725.1| PREDICTED: vacuolar protein sorting-associated protein 53 A [Gossypium arboreum] ref|XP_017626726.1| PREDICTED: vacuolar protein sorting-associated protein 53 A [Gossypium arboreum] gb|KHF99303.1| Vacuolar sorting-associated protein 53 [Gossypium arboreum] Length = 824 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +3 Query: 3 LLDIPSLGRQTSGATGYAKFVSREMSKAESLLKVILSPIDSVADTYGALI 152 LL+IPSLGRQTSGA GY+KFVSREMSKAE+LLKVILSP+DSVADTY AL+ Sbjct: 659 LLEIPSLGRQTSGAAGYSKFVSREMSKAEALLKVILSPVDSVADTYRALL 708