BLASTX nr result
ID: Chrysanthemum22_contig00010160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00010160 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY80992.1| hypothetical protein LSAT_9X109200 [Lactuca sativa] 96 2e-23 gb|KVI01988.1| hypothetical protein Ccrd_019749 [Cynara carduncu... 90 5e-21 ref|XP_023769656.1| mitochondrial import receptor subunit TOM6 h... 85 2e-19 ref|XP_022028369.1| mitochondrial import receptor subunit TOM6 h... 85 3e-19 gb|KVD98101.1| hypothetical protein Ccrd_024306 [Cynara carduncu... 81 1e-17 ref|XP_009618631.1| PREDICTED: mitochondrial import receptor sub... 76 7e-16 gb|PHT42110.1| Mitochondrial import receptor subunit TOM6 -like ... 75 1e-15 ref|XP_018449361.1| PREDICTED: mitochondrial import receptor sub... 75 1e-15 ref|XP_016539703.1| PREDICTED: mitochondrial import receptor sub... 75 2e-15 ref|XP_009798301.1| PREDICTED: mitochondrial import receptor sub... 75 3e-15 ref|XP_009596562.1| PREDICTED: mitochondrial import receptor sub... 75 3e-15 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 75 3e-15 ref|XP_002519115.1| PREDICTED: mitochondrial import receptor sub... 74 4e-15 ref|XP_003631623.2| PREDICTED: mitochondrial import receptor sub... 74 5e-15 ref|XP_012069348.1| mitochondrial import receptor subunit TOM6 h... 74 8e-15 ref|XP_004154290.1| PREDICTED: mitochondrial import receptor sub... 74 8e-15 ref|XP_015063655.1| PREDICTED: mitochondrial import receptor sub... 73 1e-14 ref|NP_564545.1| translocase of the outer mitochondrial membrane... 73 2e-14 gb|OAY25470.1| hypothetical protein MANES_17G097600 [Manihot esc... 72 2e-14 ref|XP_009107302.1| PREDICTED: mitochondrial import receptor sub... 72 2e-14 >gb|PLY80992.1| hypothetical protein LSAT_9X109200 [Lactuca sativa] Length = 67 Score = 95.9 bits (237), Expect = 2e-23 Identities = 49/62 (79%), Positives = 51/62 (82%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF*TLCYVATSLCGRS 180 KPDKEAA KQLRVHV +FG+WV AIRVAPYVLHYFS SKDELVLDF YV LCGRS Sbjct: 9 KPDKEAALKQLRVHVAMFGSWVVAIRVAPYVLHYFSGSKDELVLDF---YYVGILLCGRS 65 Query: 181 VV 186 VV Sbjct: 66 VV 67 >gb|KVI01988.1| hypothetical protein Ccrd_019749 [Cynara cardunculus var. scolymus] Length = 69 Score = 89.7 bits (221), Expect = 5e-21 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDKEAA KQLRVHV LFGAWVAAIRV PYVLHYFSDSKDELVLDF Sbjct: 9 KPDKEAALKQLRVHVALFGAWVAAIRVTPYVLHYFSDSKDELVLDF 54 >ref|XP_023769656.1| mitochondrial import receptor subunit TOM6 homolog [Lactuca sativa] Length = 54 Score = 85.1 bits (209), Expect = 2e-19 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDKEAA KQLRVHV +FG+WV AIRVAPYVLHYFS SKDELVLDF Sbjct: 9 KPDKEAALKQLRVHVAMFGSWVVAIRVAPYVLHYFSGSKDELVLDF 54 >ref|XP_022028369.1| mitochondrial import receptor subunit TOM6 homolog [Helianthus annuus] Length = 54 Score = 84.7 bits (208), Expect = 3e-19 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLD 135 KPDKEAA KQLRVHV LFG WVAAIRVAPYVLHYFS SKDELVLD Sbjct: 9 KPDKEAALKQLRVHVALFGGWVAAIRVAPYVLHYFSGSKDELVLD 53 >gb|KVD98101.1| hypothetical protein Ccrd_024306 [Cynara cardunculus var. scolymus] Length = 64 Score = 80.9 bits (198), Expect = 1e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK+ A KQLRVHV +FG+WV AIRVAPY+LHYFSD+ DELVLDF Sbjct: 9 KPDKQVALKQLRVHVAMFGSWVVAIRVAPYLLHYFSDNNDELVLDF 54 >ref|XP_009618631.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] ref|XP_016455530.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_019255608.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana attenuata] Length = 54 Score = 76.3 bits (186), Expect = 7e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLD 135 KPDK AA KQL+ HV LFG WVA IRVAPY+LHYFSDSK+EL+L+ Sbjct: 9 KPDKAAALKQLKTHVALFGTWVAVIRVAPYILHYFSDSKEELMLE 53 >gb|PHT42110.1| Mitochondrial import receptor subunit TOM6 -like protein [Capsicum baccatum] Length = 54 Score = 75.5 bits (184), Expect = 1e-15 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV LFGAWV AIRV PYVLHYFSD +EL LDF Sbjct: 9 KPDKAAALKQLKTHVALFGAWVVAIRVTPYVLHYFSDHNEELKLDF 54 >ref|XP_018449361.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Raphanus sativus] Length = 54 Score = 75.5 bits (184), Expect = 1e-15 Identities = 36/46 (78%), Positives = 36/46 (78%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQLR HV LFG WV AIR PYVL YFSDSKDEL LDF Sbjct: 9 KPDKAAALKQLRTHVALFGGWVVAIRAVPYVLSYFSDSKDELKLDF 54 >ref|XP_016539703.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] ref|XP_016539705.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] gb|PHT64434.1| Mitochondrial import receptor subunit TOM6 -like protein [Capsicum annuum] gb|PHU10563.1| Mitochondrial import receptor subunit TOM6 -like protein [Capsicum chinense] Length = 54 Score = 75.1 bits (183), Expect = 2e-15 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV LFGAWV AIRV PY+LHYFSD +EL LDF Sbjct: 9 KPDKAAALKQLKTHVALFGAWVVAIRVTPYILHYFSDHNEELKLDF 54 >ref|XP_009798301.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] ref|XP_016455397.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] Length = 54 Score = 74.7 bits (182), Expect = 3e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLD 135 KPDK AA KQL+ HV LFG WVA IRV PY+LHYFSDSK+EL+L+ Sbjct: 9 KPDKAAALKQLKTHVALFGTWVAVIRVTPYILHYFSDSKEELMLE 53 >ref|XP_009596562.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] ref|XP_009791420.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] ref|XP_016446195.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_016477444.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_016477445.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_019249059.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana attenuata] Length = 54 Score = 74.7 bits (182), Expect = 3e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLD 135 KPDK AA KQL+ HV LFGAWVA IRV PY+LHYFSD K+EL+L+ Sbjct: 9 KPDKAAALKQLKTHVALFGAWVAVIRVTPYILHYFSDQKEELLLE 53 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 74.7 bits (182), Expect = 3e-15 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV LFG WVA IRVAPY+LHYFSD K+EL L+F Sbjct: 9 KPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHYFSDQKEELKLEF 54 >ref|XP_002519115.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Ricinus communis] gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 74.3 bits (181), Expect = 4e-15 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ H +FGAWVA IRV PYVLHY SD KDEL LDF Sbjct: 9 KPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_003631623.2| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vitis vinifera] Length = 54 Score = 73.9 bits (180), Expect = 5e-15 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK A KQLR HV +FGAWVA +RV PY+LHYFSD K+EL +DF Sbjct: 9 KPDKAVALKQLRTHVVMFGAWVAVVRVTPYILHYFSDEKEELKIDF 54 >ref|XP_012069348.1| mitochondrial import receptor subunit TOM6 homolog [Jatropha curcas] gb|KDP46200.1| hypothetical protein JCGZ_10040 [Jatropha curcas] Length = 54 Score = 73.6 bits (179), Expect = 8e-15 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV +FG WVA +RVAPY+LHY SD KDEL L+F Sbjct: 9 KPDKAAALKQLKTHVAMFGVWVAVVRVAPYILHYLSDEKDELRLEF 54 >ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] ref|XP_008459248.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] ref|XP_011649217.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] ref|XP_022943932.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022943933.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022948071.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022986654.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_022986655.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_022986656.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_023007537.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_023532551.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] ref|XP_023511843.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] ref|XP_023511844.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] gb|KGN61761.1| hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 73.6 bits (179), Expect = 8e-15 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQLR HV +FG WVA IRV PYVLHY SD K+EL LDF Sbjct: 9 KPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_015063655.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum pennellii] Length = 54 Score = 73.2 bits (178), Expect = 1e-14 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV LFG WVA IRV PY+LHYFSD K+EL L+F Sbjct: 9 KPDKAAALKQLKTHVVLFGTWVAVIRVTPYILHYFSDQKEELKLEF 54 >ref|NP_564545.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gb|AEE32427.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] gb|OAP18011.1| TOM6 [Arabidopsis thaliana] Length = 54 Score = 72.8 bits (177), Expect = 2e-14 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK A KQLR HV LFG+WV IR APYVL YFSDSKDEL +DF Sbjct: 9 KPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSYFSDSKDELKIDF 54 >gb|OAY25470.1| hypothetical protein MANES_17G097600 [Manihot esculenta] Length = 54 Score = 72.4 bits (176), Expect = 2e-14 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK AA KQL+ HV +FG WVA +RV PY+LHY SD KDEL L+F Sbjct: 9 KPDKAAALKQLKTHVSMFGVWVAVVRVTPYILHYLSDEKDELKLEF 54 >ref|XP_009107302.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Brassica rapa] ref|XP_013740918.1| mitochondrial import receptor subunit TOM6 homolog [Brassica napus] ref|XP_018509380.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Brassica rapa] Length = 54 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = +1 Query: 1 KPDKEAAHKQLRVHVGLFGAWVAAIRVAPYVLHYFSDSKDELVLDF 138 KPDK A KQLR HV LFG WV AIR PYVL YFSDSK+EL LDF Sbjct: 9 KPDKAVALKQLRTHVALFGGWVVAIRAVPYVLSYFSDSKEELKLDF 54