BLASTX nr result
ID: Chrysanthemum22_contig00009849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00009849 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013898.1| protein EXECUTER 2, chloroplastic [Helianthu... 70 8e-11 ref|XP_023765016.1| protein EXECUTER 2, chloroplastic isoform X2... 69 2e-10 ref|XP_023765015.1| protein EXECUTER 2, chloroplastic isoform X1... 69 2e-10 gb|KVH98201.1| Protein of unknown function DUF3506 [Cynara cardu... 69 2e-10 emb|CDY11792.1| BnaC03g57860D [Brassica napus] 64 1e-08 ref|XP_013685350.1| protein EXECUTER 2, chloroplastic-like [Bras... 64 1e-08 ref|XP_013629958.1| PREDICTED: protein EXECUTER 2, chloroplastic... 64 1e-08 ref|XP_018451435.1| PREDICTED: protein EXECUTER 2, chloroplastic... 64 1e-08 ref|XP_013663224.1| protein EXECUTER 2, chloroplastic-like [Bras... 64 1e-08 ref|XP_009109798.1| PREDICTED: protein EXECUTER 2, chloroplastic... 64 1e-08 gb|PNT00943.1| hypothetical protein POPTR_015G075000v3 [Populus ... 62 5e-08 ref|XP_012829318.1| PREDICTED: protein EXECUTER 2, chloroplastic... 62 5e-08 ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Popu... 62 5e-08 ref|XP_010478095.1| PREDICTED: protein EXECUTER 2, chloroplastic... 62 6e-08 ref|XP_016728645.1| PREDICTED: protein EXECUTER 2, chloroplastic... 62 8e-08 gb|KJB53139.1| hypothetical protein B456_008G294800 [Gossypium r... 62 8e-08 gb|PPS05125.1| hypothetical protein GOBAR_AA15542 [Gossypium bar... 62 8e-08 gb|PPD70235.1| hypothetical protein GOBAR_DD32887 [Gossypium bar... 62 9e-08 gb|KJB53137.1| hypothetical protein B456_008G294800 [Gossypium r... 62 9e-08 ref|XP_016728103.1| PREDICTED: protein EXECUTER 2, chloroplastic... 62 9e-08 >ref|XP_022013898.1| protein EXECUTER 2, chloroplastic [Helianthus annuus] gb|OTG33683.1| Protein of unknown function (DUF3506) [Helianthus annuus] Length = 632 Score = 70.5 bits (171), Expect = 8e-11 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGNDVEFF 1 GLYVGAFGPYGTEVVQLKRKYGNWS NDVEFF Sbjct: 493 GLYVGAFGPYGTEVVQLKRKYGNWSGANDVEFF 525 >ref|XP_023765016.1| protein EXECUTER 2, chloroplastic isoform X2 [Lactuca sativa] Length = 551 Score = 69.3 bits (168), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGNDVEFF 1 GLYVGAFGPYGTEVVQL+RKYGNWS NDVEFF Sbjct: 500 GLYVGAFGPYGTEVVQLRRKYGNWSGANDVEFF 532 >ref|XP_023765015.1| protein EXECUTER 2, chloroplastic isoform X1 [Lactuca sativa] gb|PLY84563.1| hypothetical protein LSAT_1X26920 [Lactuca sativa] Length = 639 Score = 69.3 bits (168), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGNDVEFF 1 GLYVGAFGPYGTEVVQL+RKYGNWS NDVEFF Sbjct: 500 GLYVGAFGPYGTEVVQLRRKYGNWSGANDVEFF 532 >gb|KVH98201.1| Protein of unknown function DUF3506 [Cynara cardunculus var. scolymus] Length = 640 Score = 69.3 bits (168), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGNDVEFF 1 GLYVGAFGPYGTEVVQL+RKYGNWS NDVEFF Sbjct: 501 GLYVGAFGPYGTEVVQLRRKYGNWSGANDVEFF 533 >emb|CDY11792.1| BnaC03g57860D [Brassica napus] Length = 620 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD +D+EFF Sbjct: 476 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSSDIEFF 513 >ref|XP_013685350.1| protein EXECUTER 2, chloroplastic-like [Brassica napus] Length = 639 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD +D+EFF Sbjct: 495 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSSDIEFF 532 >ref|XP_013629958.1| PREDICTED: protein EXECUTER 2, chloroplastic [Brassica oleracea var. oleracea] Length = 639 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD +D+EFF Sbjct: 495 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSSDIEFF 532 >ref|XP_018451435.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Raphanus sativus] ref|XP_018451445.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Raphanus sativus] Length = 648 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD +D+EFF Sbjct: 504 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSSDIEFF 541 >ref|XP_013663224.1| protein EXECUTER 2, chloroplastic-like [Brassica napus] Length = 640 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD D+EFF Sbjct: 496 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSTDIEFF 533 >ref|XP_009109798.1| PREDICTED: protein EXECUTER 2, chloroplastic [Brassica rapa] Length = 640 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYGNW SD D+EFF Sbjct: 496 GLYVGAFGPYGTEIVQLKRKYGNWNDAEESDSTDIEFF 533 >gb|PNT00943.1| hypothetical protein POPTR_015G075000v3 [Populus trichocarpa] Length = 602 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDG----NDVEFF 1 GLYVGAFGPYGTE+VQLKRKYG+W++G +DVEFF Sbjct: 512 GLYVGAFGPYGTEIVQLKRKYGHWNNGDDQSSDVEFF 548 >ref|XP_012829318.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Erythranthe guttata] gb|EYU17659.1| hypothetical protein MIMGU_mgv1a002899mg [Erythranthe guttata] Length = 627 Score = 62.4 bits (150), Expect = 5e-08 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGN-----DVEFF 1 GLYVGAFGPYGTEVVQLKRKYGNW+ N DVEFF Sbjct: 483 GLYVGAFGPYGTEVVQLKRKYGNWNVNNDEKSSDVEFF 520 >ref|XP_002321589.2| hypothetical protein POPTR_0015s08620g [Populus trichocarpa] gb|PNT00942.1| hypothetical protein POPTR_015G075000v3 [Populus trichocarpa] Length = 655 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/37 (75%), Positives = 33/37 (89%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDG----NDVEFF 1 GLYVGAFGPYGTE+VQLKRKYG+W++G +DVEFF Sbjct: 512 GLYVGAFGPYGTEIVQLKRKYGHWNNGDDQSSDVEFF 548 >ref|XP_010478095.1| PREDICTED: protein EXECUTER 2, chloroplastic [Camelina sativa] Length = 644 Score = 62.0 bits (149), Expect = 6e-08 Identities = 28/38 (73%), Positives = 31/38 (81%), Gaps = 5/38 (13%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNW-----SDGNDVEFF 1 GLYVGAFGPYGTE+VQLKRKYG W SD +D+EFF Sbjct: 498 GLYVGAFGPYGTEIVQLKRKYGRWEDAEGSDSSDIEFF 535 >ref|XP_016728645.1| PREDICTED: protein EXECUTER 2, chloroplastic-like, partial [Gossypium hirsutum] Length = 498 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGN----DVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD + DVEFF Sbjct: 355 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESLDVEFF 391 >gb|KJB53139.1| hypothetical protein B456_008G294800 [Gossypium raimondii] Length = 516 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSD----GNDVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD +DVEFF Sbjct: 373 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESSDVEFF 409 >gb|PPS05125.1| hypothetical protein GOBAR_AA15542 [Gossypium barbadense] Length = 579 Score = 61.6 bits (148), Expect = 8e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSD----GNDVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD +DVEFF Sbjct: 436 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESSDVEFF 472 >gb|PPD70235.1| hypothetical protein GOBAR_DD32887 [Gossypium barbadense] Length = 593 Score = 61.6 bits (148), Expect = 9e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSDGN----DVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD + DVEFF Sbjct: 450 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESLDVEFF 486 >gb|KJB53137.1| hypothetical protein B456_008G294800 [Gossypium raimondii] Length = 593 Score = 61.6 bits (148), Expect = 9e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSD----GNDVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD +DVEFF Sbjct: 511 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESSDVEFF 547 >ref|XP_016728103.1| PREDICTED: protein EXECUTER 2, chloroplastic-like isoform X2 [Gossypium hirsutum] Length = 625 Score = 61.6 bits (148), Expect = 9e-08 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = -1 Query: 99 GLYVGAFGPYGTEVVQLKRKYGNWSD----GNDVEFF 1 GLYVGAFGPYGTE+VQL+RKYG WSD +DVEFF Sbjct: 511 GLYVGAFGPYGTEIVQLRRKYGRWSDADDESSDVEFF 547