BLASTX nr result
ID: Chrysanthemum22_contig00009674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00009674 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI04341.1| hypothetical protein Ccrd_017348 [Cynara carduncu... 58 4e-07 ref|XP_022021072.1| protein TPX2-like isoform X3 [Helianthus ann... 57 1e-06 ref|XP_022021071.1| protein TPX2-like isoform X2 [Helianthus ann... 57 1e-06 ref|XP_022021070.1| protein TPX2-like isoform X1 [Helianthus ann... 57 1e-06 ref|XP_022021950.1| protein TPX2-like [Helianthus annuus] >gi|11... 57 1e-06 gb|PLY81635.1| hypothetical protein LSAT_8X134661 [Lactuca sativa] 55 5e-06 ref|XP_023768846.1| protein TPX2 [Lactuca sativa] 55 5e-06 ref|XP_012452050.1| PREDICTED: protein TPX2 isoform X2 [Gossypiu... 54 9e-06 ref|XP_012452039.1| PREDICTED: protein TPX2 isoform X1 [Gossypiu... 54 9e-06 >gb|KVI04341.1| hypothetical protein Ccrd_017348 [Cynara cardunculus var. scolymus] Length = 833 Score = 58.2 bits (139), Expect = 4e-07 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 316 GESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 GE+++Q+R+AQLWFDT LTYAPSPFMHKVK Sbjct: 27 GETEDQMREAQLWFDTALTYAPSPFMHKVK 56 >ref|XP_022021072.1| protein TPX2-like isoform X3 [Helianthus annuus] Length = 775 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = +1 Query: 310 VEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 +EGE++E++R AQLWFDT LT+APSP+MHK+K Sbjct: 24 IEGETEEEMRQAQLWFDTALTHAPSPYMHKIK 55 >ref|XP_022021071.1| protein TPX2-like isoform X2 [Helianthus annuus] Length = 779 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = +1 Query: 310 VEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 +EGE++E++R AQLWFDT LT+APSP+MHK+K Sbjct: 24 IEGETEEEMRQAQLWFDTALTHAPSPYMHKIK 55 >ref|XP_022021070.1| protein TPX2-like isoform X1 [Helianthus annuus] gb|OTF86768.1| putative targeting protein for XKLP2 [Helianthus annuus] Length = 781 Score = 57.0 bits (136), Expect = 1e-06 Identities = 22/32 (68%), Positives = 30/32 (93%) Frame = +1 Query: 310 VEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 +EGE++E++R AQLWFDT LT+APSP+MHK+K Sbjct: 24 IEGETEEEMRQAQLWFDTALTHAPSPYMHKIK 55 >ref|XP_022021950.1| protein TPX2-like [Helianthus annuus] gb|OTF87216.1| putative TPX2 domain-containing protein [Helianthus annuus] Length = 776 Score = 56.6 bits (135), Expect = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 310 VEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 V+GE+D+QIR+ QLWFDT L YAPSP MHK+K Sbjct: 25 VKGETDDQIRETQLWFDTALAYAPSPIMHKIK 56 >gb|PLY81635.1| hypothetical protein LSAT_8X134661 [Lactuca sativa] Length = 769 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 Query: 316 GESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 GE+++++R AQLWFDT LTYAPSPFMHKVK Sbjct: 26 GETEDEMRVAQLWFDTALTYAPSPFMHKVK 55 >ref|XP_023768846.1| protein TPX2 [Lactuca sativa] Length = 770 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +1 Query: 316 GESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 GE+++++R AQLWFDT LTYAPSPFMHKVK Sbjct: 27 GETEDEMRVAQLWFDTALTYAPSPFMHKVK 56 >ref|XP_012452050.1| PREDICTED: protein TPX2 isoform X2 [Gossypium raimondii] gb|KJB12466.1| hypothetical protein B456_002G019900 [Gossypium raimondii] Length = 760 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +1 Query: 232 TMTLDGVRVEKVPVMDASCAILC*TLVEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 T T ++++ A C +GES+E+IRDA+LWF+T LTYAPSPFM ++K Sbjct: 7 TATATATVIDELYEFSAPCFF---DFTKGESEEEIRDAELWFETALTYAPSPFMIRIK 61 >ref|XP_012452039.1| PREDICTED: protein TPX2 isoform X1 [Gossypium raimondii] gb|KJB12467.1| hypothetical protein B456_002G019900 [Gossypium raimondii] Length = 767 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/58 (44%), Positives = 37/58 (63%) Frame = +1 Query: 232 TMTLDGVRVEKVPVMDASCAILC*TLVEGESDEQIRDAQLWFDTNLTYAPSPFMHKVK 405 T T ++++ A C +GES+E+IRDA+LWF+T LTYAPSPFM ++K Sbjct: 7 TATATATVIDELYEFSAPCFF---DFTKGESEEEIRDAELWFETALTYAPSPFMIRIK 61