BLASTX nr result
ID: Chrysanthemum22_contig00009673
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00009673 (847 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023746383.1| pentatricopeptide repeat-containing protein ... 169 5e-44 ref|XP_022035727.1| pentatricopeptide repeat-containing protein ... 164 2e-42 gb|OTG29308.1| putative pentatricopeptide repeat (PPR) superfami... 164 3e-42 ref|XP_022017475.1| pentatricopeptide repeat-containing protein ... 128 8e-30 gb|KVH88583.1| Pentatricopeptide repeat-containing protein [Cyna... 124 2e-28 ref|XP_023747997.1| pentatricopeptide repeat-containing protein ... 124 3e-28 ref|XP_017232975.1| PREDICTED: pentatricopeptide repeat-containi... 122 1e-27 ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containi... 120 4e-27 ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containi... 120 5e-27 ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containi... 120 8e-27 gb|PIN20651.1| hypothetical protein CDL12_06661 [Handroanthus im... 119 2e-26 ref|XP_019257370.1| PREDICTED: pentatricopeptide repeat-containi... 119 2e-26 ref|XP_022640797.1| pentatricopeptide repeat-containing protein ... 118 2e-26 gb|PPD76509.1| hypothetical protein GOBAR_DD26562 [Gossypium bar... 118 3e-26 ref|XP_017615790.1| PREDICTED: pentatricopeptide repeat-containi... 118 3e-26 ref|XP_016679960.1| PREDICTED: pentatricopeptide repeat-containi... 118 3e-26 ref|XP_022640796.1| pentatricopeptide repeat-containing protein ... 118 3e-26 ref|XP_017442876.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 118 3e-26 ref|XP_022640795.1| pentatricopeptide repeat-containing protein ... 118 3e-26 gb|KOM35463.1| hypothetical protein LR48_Vigan02g161300 [Vigna a... 118 3e-26 >ref|XP_023746383.1| pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Lactuca sativa] gb|PLY64258.1| hypothetical protein LSAT_7X2720 [Lactuca sativa] Length = 747 Score = 169 bits (427), Expect = 5e-44 Identities = 88/181 (48%), Positives = 125/181 (69%), Gaps = 5/181 (2%) Frame = -3 Query: 530 HEQITSLPQQSILNIAKQFNTSSKAFKFFNFIKNPSSPTSS-----FVFQTVLQLATREK 366 H Q+ SLP QS++ IA+ TS+KA KFF+FI + SP+ S +FQTV++LA RE+ Sbjct: 66 HHQLLSLPPQSLIKIARHLETSNKALKFFHFIHDNQSPSLSQLPLPSIFQTVIELAMREE 125 Query: 365 DPIFITNLYKISKEMNVSLTPISAIIIMKHLFRVKGVQECVKLYDGLDPDGKTXXXXXXX 186 D + + +L+ +SKE+ V LT SAI+++++ F VK VQE ++LY+ L+PD K Sbjct: 126 DSVPLVDLFNLSKELKVPLTSNSAILLIRYFFNVKKVQESLQLYNELEPDAKNTNVKNTL 185 Query: 185 XXXXLKCDRFDDAHQLLDEMLQPDGKVLANEMTLNVVFPVLLRRDYGKECEKFVDLLPRF 6 L+ ++F+DAH+LLDEMLQPD K NE TL+VVF VLLR +YGKE EK + L+P+F Sbjct: 186 LGLLLRFNKFEDAHKLLDEMLQPDTKFPPNETTLSVVFSVLLRWNYGKEDEKILGLIPKF 245 Query: 5 G 3 G Sbjct: 246 G 246 >ref|XP_022035727.1| pentatricopeptide repeat-containing protein At5g28460-like [Helianthus annuus] Length = 751 Score = 164 bits (415), Expect = 2e-42 Identities = 88/183 (48%), Positives = 119/183 (65%), Gaps = 7/183 (3%) Frame = -3 Query: 530 HEQITSLPQQSILNIAKQFNTSSKAFKFFNFIKNPSSPTSSF-------VFQTVLQLATR 372 ++QI SL QS++ IA++F TS+KA FFNFI+ +P+ S +FQTV+QLA R Sbjct: 66 NQQILSLTPQSLIKIAREFQTSTKALNFFNFIRENENPSLSLHPPPLDSIFQTVIQLAIR 125 Query: 371 EKDPIFITNLYKISKEMNVSLTPISAIIIMKHLFRVKGVQECVKLYDGLDPDGKTXXXXX 192 E D I L+ +SKE+ VSLT SAI ++ + + VQ+ + +YD LDPD K Sbjct: 126 EGDYASIVGLFNLSKEVKVSLTNHSAIRLISYFSCLNKVQDSMLVYDNLDPDVKNTNVRN 185 Query: 191 XXXXXXLKCDRFDDAHQLLDEMLQPDGKVLANEMTLNVVFPVLLRRDYGKECEKFVDLLP 12 LK +RFDDA QLLDEML+PD K NE+TLN+VFPVLLRRD+G + F+ L+P Sbjct: 186 IVLDLLLKSERFDDARQLLDEMLEPDAKFPPNEITLNIVFPVLLRRDWGNRTDDFIGLVP 245 Query: 11 RFG 3 +FG Sbjct: 246 KFG 248 >gb|OTG29308.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 769 Score = 164 bits (415), Expect = 3e-42 Identities = 88/183 (48%), Positives = 119/183 (65%), Gaps = 7/183 (3%) Frame = -3 Query: 530 HEQITSLPQQSILNIAKQFNTSSKAFKFFNFIKNPSSPTSSF-------VFQTVLQLATR 372 ++QI SL QS++ IA++F TS+KA FFNFI+ +P+ S +FQTV+QLA R Sbjct: 66 NQQILSLTPQSLIKIAREFQTSTKALNFFNFIRENENPSLSLHPPPLDSIFQTVIQLAIR 125 Query: 371 EKDPIFITNLYKISKEMNVSLTPISAIIIMKHLFRVKGVQECVKLYDGLDPDGKTXXXXX 192 E D I L+ +SKE+ VSLT SAI ++ + + VQ+ + +YD LDPD K Sbjct: 126 EGDYASIVGLFNLSKEVKVSLTNHSAIRLISYFSCLNKVQDSMLVYDNLDPDVKNTNVRN 185 Query: 191 XXXXXXLKCDRFDDAHQLLDEMLQPDGKVLANEMTLNVVFPVLLRRDYGKECEKFVDLLP 12 LK +RFDDA QLLDEML+PD K NE+TLN+VFPVLLRRD+G + F+ L+P Sbjct: 186 IVLDLLLKSERFDDARQLLDEMLEPDAKFPPNEITLNIVFPVLLRRDWGNRTDDFIGLVP 245 Query: 11 RFG 3 +FG Sbjct: 246 KFG 248 >ref|XP_022017475.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Helianthus annuus] ref|XP_022017476.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Helianthus annuus] gb|OTF91826.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 644 Score = 128 bits (322), Expect = 8e-30 Identities = 66/91 (72%), Positives = 73/91 (80%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+RE KLVHKH+FS GY PKTFLINTLI+MYVKF+LLD+ARKLFDEM ERNVVSWTTMIA Sbjct: 90 AVREGKLVHKHVFSAGYQPKTFLINTLINMYVKFNLLDEARKLFDEMPERNVVSWTTMIA 149 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 AF+NA L +GVRPNMFTYS Sbjct: 150 AFSNAGIKDEALKFLIFMLRNGVRPNMFTYS 180 >gb|KVH88583.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 637 Score = 124 bits (311), Expect = 2e-28 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++EAKLVHKHIFS+GY PKTFLINTL++MYVKF+LL++AR+LFD+M +RNVVSWTTMIA Sbjct: 83 AIQEAKLVHKHIFSDGYQPKTFLINTLMNMYVKFNLLNEARELFDQMPDRNVVSWTTMIA 142 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 AF+NAR L +GV PNMFTYS Sbjct: 143 AFSNARLDHEAMEFLTLMLRNGVHPNMFTYS 173 >ref|XP_023747997.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Lactuca sativa] gb|PLY63002.1| hypothetical protein LSAT_8X121220 [Lactuca sativa] Length = 645 Score = 124 bits (310), Expect = 3e-28 Identities = 60/91 (65%), Positives = 75/91 (82%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++EAKLVHKH+FSNGY+PKTFLINTL++MY KF+LL++A +LFDEM ERNVVSWTTMIA Sbjct: 90 AIQEAKLVHKHVFSNGYNPKTFLINTLMNMYSKFNLLNEAHELFDEMPERNVVSWTTMIA 149 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 AF+NA+ + +G+RPNMFTYS Sbjct: 150 AFSNAKMNDKAMEFLILMIRNGIRPNMFTYS 180 >ref|XP_017232975.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Daucus carota subsp. sativus] Length = 634 Score = 122 bits (306), Expect = 1e-27 Identities = 60/91 (65%), Positives = 69/91 (75%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+REAK+VH H+FSNGY P TFLIN +SMYVKF+LLDDA+KLFD+M ERNVVSWTTMIA Sbjct: 80 AIREAKIVHNHVFSNGYRPMTFLINVFVSMYVKFNLLDDAQKLFDQMPERNVVSWTTMIA 139 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 AF N R L DGVRPN +T+S Sbjct: 140 AFTNVRDYDKAIGFLILMLRDGVRPNSYTFS 170 >ref|XP_004139977.2| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis sativus] gb|KGN46644.1| hypothetical protein Csa_6G117760 [Cucumis sativus] Length = 624 Score = 120 bits (302), Expect = 4e-27 Identities = 58/91 (63%), Positives = 73/91 (80%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+++A+LVH+H+FSNGY PKTFLINTLI+MYVKF LLD+AR LFDEM +RNVVSWTTMI+ Sbjct: 69 AVQQARLVHEHVFSNGYEPKTFLINTLINMYVKFGLLDEARNLFDEMPDRNVVSWTTMIS 128 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++N+ L +GVRPNM+TYS Sbjct: 129 AYSNSNLNHKALDFLILMLREGVRPNMYTYS 159 >ref|XP_008448163.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Cucumis melo] Length = 624 Score = 120 bits (301), Expect = 5e-27 Identities = 58/91 (63%), Positives = 72/91 (79%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+++ +LVH+H+FSNGY PKTFLINTLI+MYVKF LLD+AR LFDEM +RNVVSWTTMI+ Sbjct: 69 AVQQGRLVHEHVFSNGYEPKTFLINTLINMYVKFGLLDEARNLFDEMPDRNVVSWTTMIS 128 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++N+ L +GVRPNMFTYS Sbjct: 129 AYSNSNLNHKALEFLILMLREGVRPNMFTYS 159 >ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804753.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804755.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804757.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804758.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_009804759.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] ref|XP_016449016.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449017.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449018.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449019.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] ref|XP_016449020.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] Length = 659 Score = 120 bits (300), Expect = 8e-27 Identities = 57/91 (62%), Positives = 73/91 (80%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+ + K VH+H+FSNGY PKTFL+NTLI+MYVKF++LD+A+ LFD+MS+RNVVSWTTMIA Sbjct: 105 AIEQGKRVHQHVFSNGYEPKTFLVNTLINMYVKFNMLDEAQALFDQMSDRNVVSWTTMIA 164 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A+++A+ L DGVRPNMFTYS Sbjct: 165 AYSSAKINNKALEFLILMLRDGVRPNMFTYS 195 >gb|PIN20651.1| hypothetical protein CDL12_06661 [Handroanthus impetiginosus] Length = 656 Score = 119 bits (297), Expect = 2e-26 Identities = 58/91 (63%), Positives = 72/91 (79%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+++ K VH+H+FSNGY PKTFLINTL++MYVKF+LLD+A+ LFD+M ERNVVSWTTMIA Sbjct: 102 AVKQGKRVHQHVFSNGYEPKTFLINTLLNMYVKFNLLDEAQILFDQMVERNVVSWTTMIA 161 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA L DGVRPNM+TYS Sbjct: 162 AYSNAELNSRALEMLIMMLRDGVRPNMYTYS 192 >ref|XP_019257370.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] ref|XP_019257371.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] ref|XP_019257372.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] gb|OIS96339.1| pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 659 Score = 119 bits (297), Expect = 2e-26 Identities = 57/91 (62%), Positives = 72/91 (79%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+ + K VH+H+FSNGY PKTFL+NTLI+MYVKF++LD A+ LFD+MS+RNVVSWTTMIA Sbjct: 105 AVEQGKRVHQHVFSNGYEPKTFLVNTLINMYVKFNMLDQAQALFDQMSDRNVVSWTTMIA 164 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A+++A+ L DGVRPNMFTYS Sbjct: 165 AYSSAKINNKALEFLILMLRDGVRPNMFTYS 195 >ref|XP_022640797.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X4 [Vigna radiata var. radiata] Length = 585 Score = 118 bits (296), Expect = 2e-26 Identities = 58/91 (63%), Positives = 71/91 (78%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++E K VH+HIFSNGYHPKTFLINTLI+MYVKF+LL++A LFD+M ERNVVSWTTMI+ Sbjct: 31 AVKEGKRVHRHIFSNGYHPKTFLINTLINMYVKFNLLEEAHVLFDKMPERNVVSWTTMIS 90 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA+ DGV PNMFT+S Sbjct: 91 AYSNAKLNDRAVRLLIFMFRDGVMPNMFTFS 121 >gb|PPD76509.1| hypothetical protein GOBAR_DD26562 [Gossypium barbadense] Length = 643 Score = 118 bits (296), Expect = 3e-26 Identities = 59/91 (64%), Positives = 70/91 (76%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+ + KLVHKH+FSNGY PKTFLIN LISMYVKF LLD+A+ LFD+M ERNVVSWTTMI+ Sbjct: 89 AVEQGKLVHKHVFSNGYQPKTFLINILISMYVKFKLLDEAQALFDQMPERNVVSWTTMIS 148 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A+ANA+ L +GV PNMFT+S Sbjct: 149 AYANAKLSDKALEFFVLMLREGVLPNMFTFS 179 >ref|XP_017615790.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Gossypium arboreum] Length = 643 Score = 118 bits (296), Expect = 3e-26 Identities = 59/91 (64%), Positives = 70/91 (76%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+ + KLVHKH+FSNGY PKTFLIN LISMYVKF LLD+A+ LFD+M ERNVVSWTTMI+ Sbjct: 89 AVEQGKLVHKHVFSNGYQPKTFLINILISMYVKFKLLDEAQALFDQMPERNVVSWTTMIS 148 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A+ANA+ L +GV PNMFT+S Sbjct: 149 AYANAKLSDKALEFFVLMLREGVLPNMFTFS 179 >ref|XP_016679960.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Gossypium hirsutum] Length = 643 Score = 118 bits (296), Expect = 3e-26 Identities = 59/91 (64%), Positives = 70/91 (76%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A+ + KLVHKH+FSNGY PKTFLIN LISMYVKF LLD+A+ LFD+M ERNVVSWTTMI+ Sbjct: 89 AVEQGKLVHKHVFSNGYQPKTFLINILISMYVKFKLLDEAQALFDQMPERNVVSWTTMIS 148 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A+ANA+ L +GV PNMFT+S Sbjct: 149 AYANAKLSDKALEFFVLMLREGVLPNMFTFS 179 >ref|XP_022640796.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X3 [Vigna radiata var. radiata] Length = 648 Score = 118 bits (296), Expect = 3e-26 Identities = 58/91 (63%), Positives = 71/91 (78%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++E K VH+HIFSNGYHPKTFLINTLI+MYVKF+LL++A LFD+M ERNVVSWTTMI+ Sbjct: 94 AVKEGKRVHRHIFSNGYHPKTFLINTLINMYVKFNLLEEAHVLFDKMPERNVVSWTTMIS 153 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA+ DGV PNMFT+S Sbjct: 154 AYSNAKLNDRAVRLLIFMFRDGVMPNMFTFS 184 >ref|XP_017442876.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Vigna angularis] Length = 652 Score = 118 bits (296), Expect = 3e-26 Identities = 58/91 (63%), Positives = 71/91 (78%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++E K VH+HIFSNGYHPKTFLINTLI+MYVKF+LL++A LFD+M ERNVVSWTTMI+ Sbjct: 98 AVKEGKRVHRHIFSNGYHPKTFLINTLINMYVKFNLLEEAHVLFDKMPERNVVSWTTMIS 157 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA+ DGV PNMFT+S Sbjct: 158 AYSNAKLNDRAVRLLVFMFRDGVMPNMFTFS 188 >ref|XP_022640795.1| pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X2 [Vigna radiata var. radiata] Length = 663 Score = 118 bits (296), Expect = 3e-26 Identities = 58/91 (63%), Positives = 71/91 (78%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++E K VH+HIFSNGYHPKTFLINTLI+MYVKF+LL++A LFD+M ERNVVSWTTMI+ Sbjct: 109 AVKEGKRVHRHIFSNGYHPKTFLINTLINMYVKFNLLEEAHVLFDKMPERNVVSWTTMIS 168 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA+ DGV PNMFT+S Sbjct: 169 AYSNAKLNDRAVRLLIFMFRDGVMPNMFTFS 199 >gb|KOM35463.1| hypothetical protein LR48_Vigan02g161300 [Vigna angularis] Length = 672 Score = 118 bits (296), Expect = 3e-26 Identities = 58/91 (63%), Positives = 71/91 (78%), Gaps = 11/91 (12%) Frame = +1 Query: 607 ALREAKLVHKHIFSNGYHPKTFLINTLISMYVKFSLLDDARKLFDEMSERNVVSWTTMIA 786 A++E K VH+HIFSNGYHPKTFLINTLI+MYVKF+LL++A LFD+M ERNVVSWTTMI+ Sbjct: 118 AVKEGKRVHRHIFSNGYHPKTFLINTLINMYVKFNLLEEAHVLFDKMPERNVVSWTTMIS 177 Query: 787 AFANAR-----------KLFDGVRPNMFTYS 846 A++NA+ DGV PNMFT+S Sbjct: 178 AYSNAKLNDRAVRLLVFMFRDGVMPNMFTFS 208