BLASTX nr result
ID: Chrysanthemum22_contig00009607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00009607 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI12018.1| Protein kinase, ATP binding site-containing prote... 61 6e-08 ref|XP_023748812.1| mitogen-activated protein kinase 3-like [Lac... 60 1e-07 ref|XP_022037175.1| mitogen-activated protein kinase 3-like [Hel... 59 3e-07 ref|XP_021977947.1| mitogen-activated protein kinase 3-like [Hel... 57 2e-06 gb|KVH94574.1| Protein kinase, ATP binding site-containing prote... 54 9e-06 >gb|KVI12018.1| Protein kinase, ATP binding site-containing protein [Cynara cardunculus var. scolymus] Length = 348 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 460 SFSFEQQVLGEEQIKDLIYEEALAHNPGFA 371 SF FEQQVLGEEQIKDLIY+EALAHNPGFA Sbjct: 319 SFEFEQQVLGEEQIKDLIYQEALAHNPGFA 348 >ref|XP_023748812.1| mitogen-activated protein kinase 3-like [Lactuca sativa] gb|PLY62365.1| hypothetical protein LSAT_8X76860 [Lactuca sativa] Length = 370 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 460 SFSFEQQVLGEEQIKDLIYEEALAHNPGFA 371 SF FEQQVLGEEQIK+LIYEEALAHNPGFA Sbjct: 341 SFEFEQQVLGEEQIKNLIYEEALAHNPGFA 370 >ref|XP_022037175.1| mitogen-activated protein kinase 3-like [Helianthus annuus] gb|OTG24124.1| putative protein kinase-like domain, Citron Rho-interacting kinase [Helianthus annuus] Length = 369 Score = 58.9 bits (141), Expect = 3e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 460 SFSFEQQVLGEEQIKDLIYEEALAHNPGFA 371 SF FEQQVL EEQIKDLIYEEALAHNPGFA Sbjct: 340 SFEFEQQVLREEQIKDLIYEEALAHNPGFA 369 >ref|XP_021977947.1| mitogen-activated protein kinase 3-like [Helianthus annuus] gb|OTG19070.1| putative mitogen-activated protein kinase 3 [Helianthus annuus] Length = 373 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 460 SFSFEQQVLGEEQIKDLIYEEALAHNPGFA 371 SF FEQQVLGEEQIKDLIY+EALAHNP +A Sbjct: 344 SFDFEQQVLGEEQIKDLIYQEALAHNPEYA 373 >gb|KVH94574.1| Protein kinase, ATP binding site-containing protein [Cynara cardunculus var. scolymus] Length = 215 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 460 SFSFEQQVLGEEQIKDLIYEEALAHNPGFA 371 SF FEQQVLGE+QIKDLI++EALAHNP +A Sbjct: 186 SFDFEQQVLGEQQIKDLIFQEALAHNPEYA 215