BLASTX nr result
ID: Chrysanthemum22_contig00009443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00009443 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH94256.1| Kinetochore protein Ndc80, partial [Cynara cardun... 58 1e-06 >gb|KVH94256.1| Kinetochore protein Ndc80, partial [Cynara cardunculus var. scolymus] Length = 345 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 501 KKKVEEKRWDLNAVIGRKWKEFVALQRECNQAIRR 397 KKKVEEK WDLNA+IG K+KE ALQ ECNQAIRR Sbjct: 186 KKKVEEKCWDLNALIGTKFKELEALQIECNQAIRR 220