BLASTX nr result
ID: Chrysanthemum22_contig00008844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00008844 (784 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013898.1| protein EXECUTER 2, chloroplastic [Helianthu... 84 1e-14 ref|XP_023765016.1| protein EXECUTER 2, chloroplastic isoform X2... 83 3e-14 ref|XP_023765015.1| protein EXECUTER 2, chloroplastic isoform X1... 83 3e-14 gb|KVH98201.1| Protein of unknown function DUF3506 [Cynara cardu... 83 3e-14 ref|XP_017637919.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 ref|XP_016486118.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 ref|XP_016504696.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 ref|XP_009783985.1| PREDICTED: protein EXECUTER 1, chloroplastic... 81 1e-13 ref|XP_009601214.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 ref|XP_016487445.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 gb|PHU15426.1| Protein EXECUTER 2, chloroplastic [Capsicum chine... 81 1e-13 gb|PHT46299.1| Protein EXECUTER 2, chloroplastic [Capsicum bacca... 81 1e-13 ref|XP_016578298.1| PREDICTED: protein EXECUTER 2, chloroplastic... 81 1e-13 ref|XP_011071839.1| protein EXECUTER 2, chloroplastic [Sesamum i... 80 2e-13 ref|XP_021825964.1| protein EXECUTER 2, chloroplastic [Prunus av... 80 3e-13 ref|XP_007210299.1| protein EXECUTER 2, chloroplastic [Prunus pe... 80 3e-13 ref|XP_016651360.1| PREDICTED: LOW QUALITY PROTEIN: protein EXEC... 80 3e-13 ref|XP_019247854.1| PREDICTED: protein EXECUTER 2, chloroplastic... 79 5e-13 gb|PKI59142.1| hypothetical protein CRG98_020508 [Punica granatum] 79 5e-13 gb|OWM90490.1| hypothetical protein CDL15_Pgr014793 [Punica gran... 79 5e-13 >ref|XP_022013898.1| protein EXECUTER 2, chloroplastic [Helianthus annuus] gb|OTG33683.1| Protein of unknown function (DUF3506) [Helianthus annuus] Length = 632 Score = 84.0 bits (206), Expect = 1e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR Sbjct: 160 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 196 >ref|XP_023765016.1| protein EXECUTER 2, chloroplastic isoform X2 [Lactuca sativa] Length = 551 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SYNPR Sbjct: 161 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYNPR 197 >ref|XP_023765015.1| protein EXECUTER 2, chloroplastic isoform X1 [Lactuca sativa] gb|PLY84563.1| hypothetical protein LSAT_1X26920 [Lactuca sativa] Length = 639 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SYNPR Sbjct: 161 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYNPR 197 >gb|KVH98201.1| Protein of unknown function DUF3506 [Cynara cardunculus var. scolymus] Length = 640 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SYNPR Sbjct: 159 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYNPR 195 >ref|XP_017637919.1| PREDICTED: protein EXECUTER 2, chloroplastic [Gossypium arboreum] Length = 653 Score = 81.3 bits (199), Expect = 1e-13 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +3 Query: 669 CMVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 C+VGWWVGYSKDSDDPFGRL+RITPGVGRF+ +SY+PR Sbjct: 171 CLVGWWVGYSKDSDDPFGRLVRITPGVGRFVARSYSPR 208 >ref|XP_016486118.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Nicotiana tabacum] Length = 518 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 168 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 204 >ref|XP_016504696.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Nicotiana tabacum] Length = 651 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 165 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 201 >ref|XP_009783985.1| PREDICTED: protein EXECUTER 1, chloroplastic [Nicotiana sylvestris] Length = 651 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 165 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 201 >ref|XP_009601214.1| PREDICTED: protein EXECUTER 2, chloroplastic [Nicotiana tomentosiformis] Length = 651 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 168 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 204 >ref|XP_016487445.1| PREDICTED: protein EXECUTER 2, chloroplastic-like [Nicotiana tabacum] Length = 652 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 168 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 204 >gb|PHU15426.1| Protein EXECUTER 2, chloroplastic [Capsicum chinense] Length = 654 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 171 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 207 >gb|PHT46299.1| Protein EXECUTER 2, chloroplastic [Capsicum baccatum] Length = 654 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 171 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 207 >ref|XP_016578298.1| PREDICTED: protein EXECUTER 2, chloroplastic [Capsicum annuum] gb|PHT79713.1| Protein EXECUTER 2, chloroplastic [Capsicum annuum] Length = 654 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 171 LVGWWVGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 207 >ref|XP_011071839.1| protein EXECUTER 2, chloroplastic [Sesamum indicum] Length = 664 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPG GRFIGKSY+PR Sbjct: 184 LVGWWVGYSKDSDDPFGRLIRITPGTGRFIGKSYSPR 220 >ref|XP_021825964.1| protein EXECUTER 2, chloroplastic [Prunus avium] Length = 660 Score = 79.7 bits (195), Expect = 3e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGY KDSDDPFGRLIRITPGVGRF+GKSY+PR Sbjct: 176 LVGWWVGYPKDSDDPFGRLIRITPGVGRFVGKSYSPR 212 >ref|XP_007210299.1| protein EXECUTER 2, chloroplastic [Prunus persica] gb|ONI08388.1| hypothetical protein PRUPE_5G174800 [Prunus persica] Length = 660 Score = 79.7 bits (195), Expect = 3e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGY KDSDDPFGRLIRITPGVGRF+GKSY+PR Sbjct: 176 LVGWWVGYPKDSDDPFGRLIRITPGVGRFVGKSYSPR 212 >ref|XP_016651360.1| PREDICTED: LOW QUALITY PROTEIN: protein EXECUTER 2, chloroplastic [Prunus mume] Length = 661 Score = 79.7 bits (195), Expect = 3e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGY KDSDDPFGRLIRITPGVGRF+GKSY+PR Sbjct: 177 LVGWWVGYPKDSDDPFGRLIRITPGVGRFVGKSYSPR 213 >ref|XP_019247854.1| PREDICTED: protein EXECUTER 2, chloroplastic [Nicotiana attenuata] gb|OIT02544.1| protein executer 2, chloroplastic [Nicotiana attenuata] Length = 649 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWW GYSKDSDDPFGRLIRITPGVGRFIG+SY+PR Sbjct: 165 LVGWWAGYSKDSDDPFGRLIRITPGVGRFIGRSYSPR 201 >gb|PKI59142.1| hypothetical protein CRG98_020508 [Punica granatum] Length = 659 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRF+G+SY+P+ Sbjct: 177 LVGWWVGYSKDSDDPFGRLIRITPGVGRFVGRSYSPK 213 >gb|OWM90490.1| hypothetical protein CDL15_Pgr014793 [Punica granatum] Length = 660 Score = 79.3 bits (194), Expect = 5e-13 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 672 MVGWWVGYSKDSDDPFGRLIRITPGVGRFIGKSYNPR 782 +VGWWVGYSKDSDDPFGRLIRITPGVGRF+G+SY+P+ Sbjct: 177 LVGWWVGYSKDSDDPFGRLIRITPGVGRFVGRSYSPK 213