BLASTX nr result
ID: Chrysanthemum22_contig00008733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00008733 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021985150.1| transmembrane protein 18 [Helianthus annuus]... 56 2e-06 >ref|XP_021985150.1| transmembrane protein 18 [Helianthus annuus] ref|XP_021985154.1| transmembrane protein 18 [Helianthus annuus] ref|XP_021985159.1| transmembrane protein 18 [Helianthus annuus] gb|OTG38191.1| hypothetical protein HannXRQ_Chr01g0027021 [Helianthus annuus] Length = 163 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = +1 Query: 31 PWLVCLMLFHDMVLMVIFTSRKNINFQVYITILSCRFTFPSLNVIFILASN 183 PWLV L+ FH MVL++IFTSRKNINFQ+Y+ +LS + + + +L+ N Sbjct: 49 PWLVGLLAFHFMVLIIIFTSRKNINFQMYLFLLSLAGVYLAERLNTVLSEN 99