BLASTX nr result
ID: Chrysanthemum22_contig00008728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00008728 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017696509.1| PREDICTED: uncharacterized protein LOC103699... 55 7e-06 >ref|XP_017696509.1| PREDICTED: uncharacterized protein LOC103699092 [Phoenix dactylifera] Length = 263 Score = 55.1 bits (131), Expect = 7e-06 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = -3 Query: 298 VEIVDEYGSILRTQKMT-AKDVYKLREGEKVLVHVNDTFQLIKGATTVCTRFMTLLLRQP 122 V+++D G + RT+ T A+DV+ L E EK++VH N+ Q IK A ++ + F+ + R+ Sbjct: 89 VDVLDGLGRVRRTRGPTRARDVWSLPEDEKIVVHCNELGQPIKNAASILSTFLGSVARKG 148 Query: 121 NLCPPEAKDWREIKARCGVLLLGELRVISSK 29 LCP W E+ + L LR++ +K Sbjct: 149 QLCPLNYTKWNEMLPSYKIEL---LRIVETK 176