BLASTX nr result
ID: Chrysanthemum22_contig00008207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00008207 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020974295.1| metallothionein-like protein type 3 [Arachis... 92 7e-22 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 91 8e-22 ref|XP_002531714.1| PREDICTED: metallothionein-like protein type... 87 4e-20 gb|OAY28682.1| hypothetical protein MANES_15G086700 [Manihot esc... 85 2e-19 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 85 2e-19 ref|XP_021606175.1| metallothionein-like protein type 3 [Manihot... 85 3e-19 ref|XP_002316894.1| METALLOTHIONEIN 3 family protein [Populus tr... 84 5e-19 gb|PKI56287.1| hypothetical protein CRG98_023306 [Punica granatum] 84 6e-19 gb|POE77317.1| metallothionein-like protein type 3 [Quercus suber] 84 7e-19 dbj|BAD95608.1| metallothionein 3 [Populus alba x Populus glandu... 84 7e-19 gb|OAY54898.1| hypothetical protein MANES_03G110500 [Manihot esc... 84 9e-19 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 84 9e-19 ref|XP_002525821.1| PREDICTED: metallothionein-like protein type... 83 1e-18 ref|NP_001340546.1| type 3 metallothionein MT3 [Glycine max] >gi... 83 2e-18 gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudom... 82 5e-18 ref|XP_021663202.1| metallothionein-like protein type 3 [Hevea b... 82 5e-18 gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus g... 82 6e-18 dbj|GAV92557.1| hypothetical protein CFOL_v3_35935 [Cephalotus f... 81 8e-18 gb|KHN05949.1| Metallothionein-like protein type 3 [Glycine soja... 81 1e-17 ref|XP_021894753.1| metallothionein-like protein type 3 [Carica ... 81 1e-17 >ref|XP_020974295.1| metallothionein-like protein type 3 [Arachis ipaensis] Length = 86 Score = 92.0 bits (227), Expect = 7e-22 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +2 Query: 158 KKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KGN Y V +VET+K VET++MEVPA ENDGKCKCGANCSCTNCTCGH Sbjct: 38 RKGNKYGVDIVETEKRMVETVVMEVPAGENDGKCKCGANCSCTNCTCGH 86 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 91.3 bits (225), Expect = 8e-22 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +2 Query: 161 KGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 KGN Y V +VET+K VET++MEVPA ENDGKCKCGANCSCTNCTCGH Sbjct: 18 KGNKYGVDIVETEKRMVETVVMEVPAGENDGKCKCGANCSCTNCTCGH 65 >ref|XP_002531714.1| PREDICTED: metallothionein-like protein type 3 [Ricinus communis] gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 87.0 bits (214), Expect = 4e-20 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS+V TI+MEVPAAE+DGKCKCGA+C+C NCTCGH Sbjct: 17 VKKGSSYTADVVETEKSSVSTIVMEVPAAEHDGKCKCGASCTCVNCTCGH 66 >gb|OAY28682.1| hypothetical protein MANES_15G086700 [Manihot esculenta] Length = 66 Score = 85.1 bits (209), Expect = 2e-19 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V TI+MEVPAAENDGKCKC A C+CT CTCGH Sbjct: 17 VKKGSSYTADIVETEKSFVSTIVMEVPAAENDGKCKCAAGCTCTTCTCGH 66 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 85.1 bits (209), Expect = 2e-19 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T +MEVPA ENDGKCKCGANC+CT CTCGH Sbjct: 17 VKKGSSYTADIVETEKSHVSTGVMEVPATENDGKCKCGANCTCTTCTCGH 66 >ref|XP_021606175.1| metallothionein-like protein type 3 [Manihot esculenta] gb|OAY54899.1| hypothetical protein MANES_03G110500 [Manihot esculenta] Length = 67 Score = 84.7 bits (208), Expect = 3e-19 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAA-ENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T++MEVPAA ENDGKCKCGANC+CT CTCGH Sbjct: 17 VKKGSSYTADIVETEKSFVSTVVMEVPAAAENDGKCKCGANCTCTTCTCGH 67 >ref|XP_002316894.1| METALLOTHIONEIN 3 family protein [Populus trichocarpa] gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gb|ABK95928.1| unknown [Populus trichocarpa] gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 84.3 bits (207), Expect = 5e-19 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T +MEVPA ENDGKCKCGANC+CT CTCGH Sbjct: 17 VKKGSSYTADIVETEKSHVYTGVMEVPATENDGKCKCGANCTCTTCTCGH 66 >gb|PKI56287.1| hypothetical protein CRG98_023306 [Punica granatum] Length = 65 Score = 84.0 bits (206), Expect = 6e-19 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y + +VET+KS + ++M+ PAAENDGKCKCG++CSCTNCTCGH Sbjct: 16 VKKGSSYTIDVVETEKSYDDAVVMDAPAAENDGKCKCGSSCSCTNCTCGH 65 >gb|POE77317.1| metallothionein-like protein type 3 [Quercus suber] Length = 66 Score = 84.0 bits (206), Expect = 7e-19 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y + +VET KS T++M+ PAAE+DGKCKCGA+CSCTNCTCGH Sbjct: 17 VKKGSSYGLVIVETDKSYSNTVVMDAPAAEHDGKCKCGASCSCTNCTCGH 66 >dbj|BAD95608.1| metallothionein 3 [Populus alba x Populus glandulosa] Length = 66 Score = 84.0 bits (206), Expect = 7e-19 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T MEVPA ENDGKCKCGANC+CT CTCGH Sbjct: 17 VKKGSSYTAGIVETEKSYVSTGAMEVPATENDGKCKCGANCTCTTCTCGH 66 >gb|OAY54898.1| hypothetical protein MANES_03G110500 [Manihot esculenta] Length = 65 Score = 83.6 bits (205), Expect = 9e-19 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +2 Query: 158 KKGNGYDVTLVETQKSTVETILMEVPAA-ENDGKCKCGANCSCTNCTCGH 304 KKG+ Y +VET+KS V T++MEVPAA ENDGKCKCGANC+CT CTCGH Sbjct: 16 KKGSSYTADIVETEKSFVSTVVMEVPAAAENDGKCKCGANCTCTTCTCGH 65 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 83.6 bits (205), Expect = 9e-19 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T++MEVPA E DGKC+CGA C+CTNCTCGH Sbjct: 17 VKKGSSYTADIVETEKSFVSTVVMEVPATEPDGKCRCGAGCTCTNCTCGH 66 >ref|XP_002525821.1| PREDICTED: metallothionein-like protein type 3 [Ricinus communis] gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 83.2 bits (204), Expect = 1e-18 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V TI+M+VPAAE+DGKCKCGA+C+C CTCGH Sbjct: 17 VKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCKCGASCTCVTCTCGH 66 >ref|NP_001340546.1| type 3 metallothionein MT3 [Glycine max] gb|KHN35757.1| Metallothionein-like protein type 3 [Glycine soja] gb|KRH55289.1| hypothetical protein GLYMA_06G242900 [Glycine max] Length = 64 Score = 82.8 bits (203), Expect = 2e-18 Identities = 34/48 (70%), Positives = 43/48 (89%) Frame = +2 Query: 161 KGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 KGN Y V +VET+KS +ET++M+VPAAE+DGKCKCG NC+CT+CTCGH Sbjct: 18 KGNSYGV-IVETEKSYIETVVMDVPAAEHDGKCKCGTNCTCTDCTCGH 64 >gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 82.4 bits (202), Expect = 5e-18 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = +2 Query: 86 LSYFKLLNMXXXXXXXXXXXXXX-IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCK 262 +SYF++L M +KKG+ Y + +VET KS VETI+M+ PAAE+DGKCK Sbjct: 14 ISYFQILAMSSTCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAAEHDGKCK 73 Query: 263 CGANCSCTNCTCG 301 CG +CSCT+CTCG Sbjct: 74 CGPSCSCTSCTCG 86 >ref|XP_021663202.1| metallothionein-like protein type 3 [Hevea brasiliensis] Length = 66 Score = 81.6 bits (200), Expect = 5e-18 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y +VET+KS V T++MEVPA E DGKC+CGA C+CT+CTCGH Sbjct: 17 VKKGSSYTADIVETEKSFVSTVVMEVPATEPDGKCRCGAGCTCTDCTCGH 66 >gb|KCW67342.1| hypothetical protein EUGRSUZ_F01127 [Eucalyptus grandis] Length = 69 Score = 81.6 bits (200), Expect = 6e-18 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +2 Query: 158 KKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCG 301 KKG+ Y VET+KS +ET+ M+ PAAENDGKCKCG++C+CTNCTCG Sbjct: 18 KKGSSYAADFVETEKSHIETVFMDAPAAENDGKCKCGSSCACTNCTCG 65 >dbj|GAV92557.1| hypothetical protein CFOL_v3_35935 [Cephalotus follicularis] dbj|GAV91687.1| hypothetical protein CFOL_v3_35077 [Cephalotus follicularis] dbj|GAV88361.1| hypothetical protein CFOL_v3_31784 [Cephalotus follicularis] Length = 66 Score = 81.3 bits (199), Expect = 8e-18 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y VET+KS V ++M+ PAAEND KCKCGANCSCT CTCGH Sbjct: 17 VKKGSSYTADFVETEKSYVSYVVMDAPAAENDPKCKCGANCSCTTCTCGH 66 >gb|KHN05949.1| Metallothionein-like protein type 3 [Glycine soja] gb|KRH26140.1| hypothetical protein GLYMA_12G154300 [Glycine max] Length = 64 Score = 80.9 bits (198), Expect = 1e-17 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +2 Query: 161 KGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 KGN Y V +VET+KS +ET+ M+VPAAE+DGKCKCG NC+CT+CTCGH Sbjct: 18 KGNSYGV-IVETEKSYIETVDMDVPAAEHDGKCKCGTNCTCTDCTCGH 64 >ref|XP_021894753.1| metallothionein-like protein type 3 [Carica papaya] sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 emb|CAA69624.1| metallothionein-like protein [Carica papaya] gb|AER26532.1| metallothionein-like protein [Carica papaya] gb|KRY02812.1| Metallothionein-like protein type 3 [Trichinella patagoniensis] gb|KRZ64583.1| Metallothionein-like protein type 3, partial [Trichinella sp. T8] Length = 65 Score = 80.9 bits (198), Expect = 1e-17 Identities = 32/50 (64%), Positives = 42/50 (84%) Frame = +2 Query: 155 IKKGNGYDVTLVETQKSTVETILMEVPAAENDGKCKCGANCSCTNCTCGH 304 +KKG+ Y ++ET+KS + T++M+ PAAENDGKCKCG +CSCTNCTCGH Sbjct: 17 VKKGSSYTADIIETEKS-IMTVVMDAPAAENDGKCKCGPSCSCTNCTCGH 65