BLASTX nr result
ID: Chrysanthemum22_contig00008113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00008113 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13853.1| hypothetical protein CDL12_13525 [Handroanthus im... 57 8e-07 gb|PIN13852.1| hypothetical protein CDL12_13524 [Handroanthus im... 54 7e-06 >gb|PIN13853.1| hypothetical protein CDL12_13525 [Handroanthus impetiginosus] Length = 185 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/68 (38%), Positives = 44/68 (64%) Frame = +3 Query: 195 STSYQQQQDAHEDEVFNELTRILFECLDSVDNEHKGLLLRKIFLELEKERDIEKFLVKKL 374 S S+ + E E +EL +IL ECL D + +LLRK FLE+EKE +E+FLV+++ Sbjct: 66 SRSFSEAGKREEVEAVDELLQILVECLKEADMRTREVLLRKFFLEIEKETSLEEFLVERI 125 Query: 375 KDTQVKVI 398 ++++++ Sbjct: 126 NKSKIRLL 133 >gb|PIN13852.1| hypothetical protein CDL12_13524 [Handroanthus impetiginosus] Length = 181 Score = 53.9 bits (128), Expect = 7e-06 Identities = 25/68 (36%), Positives = 42/68 (61%) Frame = +3 Query: 195 STSYQQQQDAHEDEVFNELTRILFECLDSVDNEHKGLLLRKIFLELEKERDIEKFLVKKL 374 S S+ + E +EL +IL ECL D K +LLRK F E+EKE +E+FLV+++ Sbjct: 62 SRSFSEAGKNEAAEAVDELLQILVECLKEADMRTKEVLLRKFFFEIEKETSLEEFLVERI 121 Query: 375 KDTQVKVI 398 ++++++ Sbjct: 122 NKSKIRLL 129