BLASTX nr result
ID: Chrysanthemum22_contig00007729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007729 (701 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH90692.1| hypothetical protein Ccrd_007276 [Cynara carduncu... 62 2e-07 ref|XP_022026217.1| splicing factor U2af small subunit B-like [H... 58 4e-06 >gb|KVH90692.1| hypothetical protein Ccrd_007276 [Cynara cardunculus var. scolymus] Length = 319 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = +1 Query: 352 HRNTSRLHMRKCS-SSESKRPHSPVREGSEARRAKNEQWNRLTEEA 486 HR+TS LH R+ S SSE +R HSPVREGSE RRAK EQWNR E+A Sbjct: 238 HRSTSPLHRRERSRSSEGRRHHSPVREGSEERRAKIEQWNRQREQA 283 >ref|XP_022026217.1| splicing factor U2af small subunit B-like [Helianthus annuus] ref|XP_022026218.1| splicing factor U2af small subunit B-like [Helianthus annuus] ref|XP_022026219.1| splicing factor U2af small subunit B-like [Helianthus annuus] gb|OTG35274.1| putative splicing factor U2af small subunit A [Helianthus annuus] Length = 321 Score = 57.8 bits (138), Expect = 4e-06 Identities = 37/73 (50%), Positives = 44/73 (60%), Gaps = 3/73 (4%) Frame = +1 Query: 277 RRYGTQERPPADTCKYTDSVHYNFG--HRNTSRLHMRKCSSSESKRPH-SPVREGSEARR 447 RRY ++R D + D H + HR+TS LH R+ S S R H SPVREGSE RR Sbjct: 220 RRYDDRDR---DYDRERDYYHESRSRRHRSTSPLHRRERSRSSEGRKHLSPVREGSEERR 276 Query: 448 AKNEQWNRLTEEA 486 AK EQWNR E+A Sbjct: 277 AKIEQWNRQREQA 289