BLASTX nr result
ID: Chrysanthemum22_contig00007633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007633 (837 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736186.1| protein SRC2-like [Lactuca sativa] >gi|13223... 79 5e-13 gb|KVH91589.1| C2 calcium-dependent membrane targeting [Cynara c... 64 4e-08 ref|XP_008801062.1| PREDICTED: protein SRC2-like [Phoenix dactyl... 60 2e-06 >ref|XP_023736186.1| protein SRC2-like [Lactuca sativa] gb|PLY71974.1| hypothetical protein LSAT_5X53581 [Lactuca sativa] Length = 362 Score = 79.0 bits (193), Expect = 5e-13 Identities = 41/61 (67%), Positives = 44/61 (72%) Frame = -1 Query: 837 TAYPAGSKPNKTDEPVTAYPNLKPNKADEPVTAYPNLNADQAYPPSKPGKVDEHVTAYPA 658 TAYPAG KPN DEPVTAYP KPNK DEP TAYP +YP +KP K D+ VTAYPA Sbjct: 152 TAYPAG-KPNNVDEPVTAYPAGKPNKVDEPFTAYP------SYPGAKPNKGDDAVTAYPA 204 Query: 657 V 655 V Sbjct: 205 V 205 >gb|KVH91589.1| C2 calcium-dependent membrane targeting [Cynara cardunculus var. scolymus] Length = 340 Score = 64.3 bits (155), Expect = 4e-08 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 837 TAYPAGSKPNKTDEPVTAYPNLKPNKADEPVTAYPNLNADQAYPP 703 TAYPAG KPNK +EP+TAYP K +K DEPVTAYP + AYPP Sbjct: 152 TAYPAG-KPNKAEEPITAYPAGKADKKDEPVTAYPAAGSSSAYPP 195 >ref|XP_008801062.1| PREDICTED: protein SRC2-like [Phoenix dactylifera] Length = 374 Score = 59.7 bits (143), Expect = 2e-06 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = -1 Query: 834 AYPAGSKPNKTDEPVTAYPNL-KPNKADEPVTAYPNLNADQAYPPSKPGKVDEHVTAYPA 658 AYP K K EPVTAYP L K KAD+PVTAYP PP K K DE VTAYPA Sbjct: 206 AYPPPGKAPKAGEPVTAYPPLGKTPKADDPVTAYP--------PPVKAPKADEPVTAYPA 257