BLASTX nr result
ID: Chrysanthemum22_contig00007523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007523 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPD88351.1| hypothetical protein GOBAR_DD14704 [Gossypium bar... 51 7e-06 >gb|PPD88351.1| hypothetical protein GOBAR_DD14704 [Gossypium barbadense] Length = 66 Score = 51.2 bits (121), Expect = 7e-06 Identities = 26/45 (57%), Positives = 29/45 (64%) Frame = +2 Query: 62 CVLIRRTCPGKGKRPGKSGNRF*KSIGLGFNT*RDNIEVSFELKV 196 CV+ KGKRPGK GNRF KSIGLGF R+ IE SF K+ Sbjct: 11 CVIFSSKKSTKGKRPGKRGNRFWKSIGLGFKAPREAIEGSFSFKL 55