BLASTX nr result
ID: Chrysanthemum22_contig00007277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007277 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AUF72255.1| phytoene desaturase 221, partial [Chrysanthemum i... 61 5e-10 gb|AUF72254.1| phytoene desaturase 361, partial [Chrysanthemum i... 61 1e-09 dbj|BAE79552.1| phytoene desaturase [Chrysanthemum x morifolium] 64 2e-09 gb|AUF72253.1| phytoene desaturase 491, partial [Chrysanthemum i... 61 4e-09 ref|XP_003601736.2| phytoene dehydrogenase/chromoplastic protein... 60 4e-09 gb|ABQ85547.1| phytoene desaturase, partial [Medicago truncatula] 59 5e-09 gb|APB08594.1| phytoene desaturase [Rhododendron molle] 62 1e-08 dbj|BAS69430.1| phytoene desaturase [Rhododendron kiusianum x Rh... 62 1e-08 dbj|BAS69429.1| phytoene desaturase [Rhododendron japonicum f. f... 62 1e-08 ref|XP_016562403.1| PREDICTED: 15-cis-phytoene desaturase, chlor... 62 1e-08 gb|PON95544.1| Phytoene desaturase [Trema orientalis] 62 1e-08 ref|XP_003601735.2| phytoene dehydrogenase/chromoplastic protein... 59 2e-08 gb|AGU91433.1| phytoene desaturase, partial [Chrysanthemum boreale] 61 2e-08 ref|XP_020213388.1| phytoene dehydrogenase, chloroplastic/chromo... 61 2e-08 gb|ATU07258.1| phytoene desaturase [Inula linariifolia] 61 2e-08 gb|KYP75657.1| hypothetical protein KK1_019850 [Cajanus cajan] 61 2e-08 ref|XP_016497510.1| PREDICTED: phytoene dehydrogenase, chloropla... 59 3e-08 gb|ABN04117.1| choloroplast phytoene desaturase, partial [Glycin... 58 4e-08 ref|XP_010246062.1| PREDICTED: 15-cis-phytoene desaturase, chlor... 60 4e-08 gb|PNT04955.1| hypothetical protein POPTR_014G148700v3 [Populus ... 60 4e-08 >gb|AUF72255.1| phytoene desaturase 221, partial [Chrysanthemum indicum] Length = 74 Score = 61.2 bits (147), Expect = 5e-10 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 22 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 57 >gb|AUF72254.1| phytoene desaturase 361, partial [Chrysanthemum indicum] Length = 120 Score = 61.2 bits (147), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 68 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 103 >dbj|BAE79552.1| phytoene desaturase [Chrysanthemum x morifolium] Length = 572 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ E FCAQAIVQ Sbjct: 519 PIEGFYLAGDYTKQKYLASMEGAVLSEKFCAQAIVQ 554 >gb|AUF72253.1| phytoene desaturase 491, partial [Chrysanthemum indicum] Length = 164 Score = 61.2 bits (147), Expect = 4e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 112 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 147 >ref|XP_003601736.2| phytoene dehydrogenase/chromoplastic protein [Medicago truncatula] gb|AES71987.2| phytoene dehydrogenase/chromoplastic protein [Medicago truncatula] Length = 141 Score = 60.5 bits (145), Expect = 4e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQV 228 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQV Sbjct: 88 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQV 124 >gb|ABQ85547.1| phytoene desaturase, partial [Medicago truncatula] Length = 81 Score = 58.9 bits (141), Expect = 5e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQ Sbjct: 27 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ 62 >gb|APB08594.1| phytoene desaturase [Rhododendron molle] Length = 580 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 PVEGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 526 PVEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 561 >dbj|BAS69430.1| phytoene desaturase [Rhododendron kiusianum x Rhododendron indicum] dbj|BAS69572.1| phytoene desaturase [Rhododendron kiusianum x Rhododendron indicum] Length = 580 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 PVEGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 526 PVEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 561 >dbj|BAS69429.1| phytoene desaturase [Rhododendron japonicum f. flavum] Length = 580 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 PVEGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 526 PVEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 561 >ref|XP_016562403.1| PREDICTED: 15-cis-phytoene desaturase, chloroplastic/chromoplastic [Capsicum annuum] ref|XP_016562404.1| PREDICTED: 15-cis-phytoene desaturase, chloroplastic/chromoplastic [Capsicum annuum] ref|XP_016562405.1| PREDICTED: 15-cis-phytoene desaturase, chloroplastic/chromoplastic [Capsicum annuum] gb|PHT88882.1| Phytoene dehydrogenase, chloroplastic/chromoplastic [Capsicum annuum] Length = 582 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 PVEGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 528 PVEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 563 >gb|PON95544.1| Phytoene desaturase [Trema orientalis] Length = 583 Score = 61.6 bits (148), Expect = 1e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 PVEGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 529 PVEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 564 >ref|XP_003601735.2| phytoene dehydrogenase/chromoplastic protein [Medicago truncatula] gb|AES71986.2| phytoene dehydrogenase/chromoplastic protein [Medicago truncatula] Length = 142 Score = 58.9 bits (141), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQ Sbjct: 88 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ 123 >gb|AGU91433.1| phytoene desaturase, partial [Chrysanthemum boreale] Length = 555 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 513 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 548 >ref|XP_020213388.1| phytoene dehydrogenase, chloroplastic/chromoplastic [Cajanus cajan] Length = 570 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 516 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 551 >gb|ATU07258.1| phytoene desaturase [Inula linariifolia] Length = 581 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 528 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 563 >gb|KYP75657.1| hypothetical protein KK1_019850 [Cajanus cajan] Length = 584 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ FCAQAIVQ Sbjct: 530 PIEGFYLAGDYTKQKYLASMEGAVLSGKFCAQAIVQ 565 >ref|XP_016497510.1| PREDICTED: phytoene dehydrogenase, chloroplastic/chromoplastic-like, partial [Nicotiana tabacum] Length = 169 Score = 58.9 bits (141), Expect = 3e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQ Sbjct: 115 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ 150 >gb|ABN04117.1| choloroplast phytoene desaturase, partial [Glycine max] Length = 143 Score = 58.2 bits (139), Expect = 4e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQ 225 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQ Sbjct: 104 PLEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQ 139 >ref|XP_010246062.1| PREDICTED: 15-cis-phytoene desaturase, chloroplastic/chromoplastic isoform X2 [Nelumbo nucifera] Length = 558 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQV 228 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQV Sbjct: 516 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQV 552 >gb|PNT04955.1| hypothetical protein POPTR_014G148700v3 [Populus trichocarpa] Length = 561 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 118 PVEGFYLDGDYTKQKYLASMEGTVV*EIFCAQAIVQV 228 P+EGFYL GDYTKQKYLASMEG V+ CAQAIVQV Sbjct: 522 PIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQAIVQV 558