BLASTX nr result
ID: Chrysanthemum22_contig00007268
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007268 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF86889.1| putative NADH dehydrogenase [ubiquinone] 1 beta s... 50 2e-06 >gb|OTF86889.1| putative NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2 [Helianthus annuus] Length = 84 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 384 LEASMGRARAWTWRRTLGVQMIKRDHKTIS 295 + AS+GRA WTWRRTLG +MIKRDHKTIS Sbjct: 54 MAASLGRA--WTWRRTLGAKMIKRDHKTIS 81 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 425 ILYRAKQDGPVVL 387 ILYRAKQDGPVVL Sbjct: 39 ILYRAKQDGPVVL 51