BLASTX nr result
ID: Chrysanthemum22_contig00007179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007179 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF86421.1| putative DNA helicase, UvrD/REP type, P-loop cont... 59 1e-07 gb|KVH96354.1| DNA helicase, UvrD-like, C-terminal [Cynara cardu... 57 7e-07 gb|PLY73427.1| hypothetical protein LSAT_4X107181 [Lactuca sativa] 57 1e-06 >gb|OTF86421.1| putative DNA helicase, UvrD/REP type, P-loop containing nucleoside triphosphate hydrolase [Helianthus annuus] Length = 1058 Score = 59.3 bits (142), Expect = 1e-07 Identities = 39/84 (46%), Positives = 50/84 (59%), Gaps = 3/84 (3%) Frame = +3 Query: 3 QLCFM*PEDKYSEILTEVHHLRAIAVNARASYNEMRKLFEEATKLFNSIGKKELADER*R 182 Q+CF+ D YSE L + +HLR + RAS E KL ++A +LFNSIGKKELA E Sbjct: 975 QMCFLKAGDIYSENLAKAYHLRTLGGYGRASQLEREKLLKDAAELFNSIGKKELAAECFY 1034 Query: 183 IIEQ-QAAYYFL--C*VPFVIQFI 245 IE + A FL C FV++ I Sbjct: 1035 EIEDFRTAGIFLSSCLCSFVVKSI 1058 >gb|KVH96354.1| DNA helicase, UvrD-like, C-terminal [Cynara cardunculus var. scolymus] Length = 1503 Score = 57.0 bits (136), Expect = 7e-07 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +3 Query: 3 QLCFM*PEDKYSEILTEVHHLRAIAVNARASYNEMRKLFEEATKLFNSIGKKELADE 173 Q+CF+ DK S L E +HLRA+A RAS E +KLF++A LF IGK ELA E Sbjct: 1021 QVCFLKAADKNSARLAEAYHLRALADGPRASQLERKKLFKDAAMLFREIGKTELAAE 1077 >gb|PLY73427.1| hypothetical protein LSAT_4X107181 [Lactuca sativa] Length = 2144 Score = 56.6 bits (135), Expect = 1e-06 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = +3 Query: 3 QLCFM*PEDKYSEILTEVHHLRAIAVNARASYNEMRKLFEEATKLFNSIGKKELADE 173 ++CFM EDKYSE L E + L AIA +S E +K+F+EA +LF S+GK LA E Sbjct: 1020 KMCFMKAEDKYSERLAEAYQLHAIAEGINSSEIERKKVFKEAAELFQSLGKHMLAAE 1076