BLASTX nr result
ID: Chrysanthemum22_contig00007027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00007027 (1808 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG07922.1| hypothetical protein HannXRQ_Chr11g0335911 [Helia... 63 2e-06 ref|XP_021993460.1| UPF0505 protein C16orf62 homolog [Helianthus... 63 2e-06 gb|KVI10346.1| hypothetical protein Ccrd_011259, partial [Cynara... 61 7e-06 >gb|OTG07922.1| hypothetical protein HannXRQ_Chr11g0335911 [Helianthus annuus] Length = 889 Score = 62.8 bits (151), Expect = 2e-06 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 1278 INLAVAWLLMDTYEAQFYPTLFDQAIDVMDMLGNMIWEWIKEKRPF 1141 +++ VA LLMDT AQFYPTLF A D+MDMLG+M+WE IKEK F Sbjct: 150 LSIKVARLLMDTCVAQFYPTLFVLATDIMDMLGDMVWERIKEKAEF 195 >ref|XP_021993460.1| UPF0505 protein C16orf62 homolog [Helianthus annuus] ref|XP_021993461.1| UPF0505 protein C16orf62 homolog [Helianthus annuus] Length = 913 Score = 62.8 bits (151), Expect = 2e-06 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 1278 INLAVAWLLMDTYEAQFYPTLFDQAIDVMDMLGNMIWEWIKEKRPF 1141 +++ VA LLMDT AQFYPTLF A D+MDMLG+M+WE IKEK F Sbjct: 174 LSIKVARLLMDTCVAQFYPTLFVLATDIMDMLGDMVWERIKEKAEF 219 >gb|KVI10346.1| hypothetical protein Ccrd_011259, partial [Cynara cardunculus var. scolymus] Length = 741 Score = 60.8 bits (146), Expect = 7e-06 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 1278 INLAVAWLLMDTYEAQFYPTLFDQAIDVMDMLGNMIWEWIKEKRPF 1141 +++ VA LLMDT AQFYP+LF A D+MDMLG+M+WE IK+K F Sbjct: 207 LSIKVAMLLMDTSVAQFYPSLFVLATDIMDMLGDMVWERIKQKAEF 252