BLASTX nr result
ID: Chrysanthemum22_contig00005898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005898 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV25693.1| mitochondrial dicarboxylate/tricarboxylate transp... 38 1e-07 gb|PIN00849.1| Mitochondrial oxoglutarate/malate carrier protein... 39 3e-07 ref|XP_012854678.1| PREDICTED: mitochondrial dicarboxylate/trica... 35 3e-06 gb|EYU23008.1| hypothetical protein MIMGU_mgv1a0131031mg, partia... 35 3e-06 gb|EPS57673.1| hypothetical protein M569_17144, partial [Genlise... 35 3e-06 ref|XP_019155507.1| PREDICTED: mitochondrial dicarboxylate/trica... 48 3e-06 ref|XP_010254423.1| PREDICTED: mitochondrial dicarboxylate/trica... 39 4e-06 gb|PLY95681.1| hypothetical protein LSAT_2X52420 [Lactuca sativa] 47 5e-06 ref|XP_023750262.1| mitochondrial dicarboxylate/tricarboxylate t... 47 5e-06 gb|KVH90853.1| Mitochondrial carrier domain-containing protein [... 47 5e-06 gb|OTF97701.1| putative mitochondrial 2-oxoglutarate/malate carr... 47 7e-06 ref|XP_023754871.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 ref|XP_022009344.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 ref|XP_022026517.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 ref|XP_022001311.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 gb|KVI08328.1| Mitochondrial carrier domain-containing protein [... 47 7e-06 ref|NP_197477.1| Mitochondrial substrate carrier family protein ... 47 7e-06 ref|XP_020877544.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 ref|NP_001312891.1| mitochondrial dicarboxylate/tricarboxylate t... 47 7e-06 gb|AAU05318.1| putative dicarboxylate/tricarboxylate carrier, pa... 47 7e-06 >gb|KZV25693.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC [Dorcoceras hygrometricum] Length = 641 Score = 37.7 bits (86), Expect(3) = 1e-07 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 80 WILTNKALEANDGKPL 127 WILTNKALEANDGKPL Sbjct: 138 WILTNKALEANDGKPL 153 Score = 34.7 bits (78), Expect(3) = 1e-07 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI A VG+ Sbjct: 152 PLPLYQKALCGLTAGAIGATVGS 174 Score = 30.8 bits (68), Expect(3) = 1e-07 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 172 VGSPADLALIRMQADATL 189 >gb|PIN00849.1| Mitochondrial oxoglutarate/malate carrier protein [Handroanthus impetiginosus] Length = 278 Score = 38.5 bits (88), Expect(3) = 3e-07 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI ACVG+ Sbjct: 82 PLPLYQKALCGLTAGAIGACVGS 104 Score = 32.3 bits (72), Expect(3) = 3e-07 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +2 Query: 83 ILTNKALEANDGKPL 127 ILTNKA+EANDGKPL Sbjct: 69 ILTNKAVEANDGKPL 83 Score = 30.8 bits (68), Expect(3) = 3e-07 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 102 VGSPADLALIRMQADATL 119 >ref|XP_012854678.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like, partial [Erythranthe guttata] Length = 218 Score = 34.7 bits (78), Expect(3) = 3e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI A VG+ Sbjct: 22 PLPLYQKALCGLTAGAIGASVGS 44 Score = 32.7 bits (73), Expect(3) = 3e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +2 Query: 83 ILTNKALEANDGKPL 127 ILTNKA+EANDGKPL Sbjct: 9 ILTNKAIEANDGKPL 23 Score = 30.8 bits (68), Expect(3) = 3e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 42 VGSPADLALIRMQADATL 59 >gb|EYU23008.1| hypothetical protein MIMGU_mgv1a0131031mg, partial [Erythranthe guttata] Length = 210 Score = 34.7 bits (78), Expect(3) = 3e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI A VG+ Sbjct: 14 PLPLYQKALCGLTAGAIGASVGS 36 Score = 32.7 bits (73), Expect(3) = 3e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +2 Query: 83 ILTNKALEANDGKPL 127 ILTNKA+EANDGKPL Sbjct: 1 ILTNKAIEANDGKPL 15 Score = 30.8 bits (68), Expect(3) = 3e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 34 VGSPADLALIRMQADATL 51 >gb|EPS57673.1| hypothetical protein M569_17144, partial [Genlisea aurea] Length = 210 Score = 34.7 bits (78), Expect(3) = 3e-06 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI A VG+ Sbjct: 15 PLPLYQKALCGLTAGAIGASVGS 37 Score = 32.7 bits (73), Expect(3) = 3e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +2 Query: 83 ILTNKALEANDGKPL 127 ILTNKA+EANDGKPL Sbjct: 2 ILTNKAIEANDGKPL 16 Score = 30.8 bits (68), Expect(3) = 3e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 35 VGSPADLALIRMQADATL 52 >ref|XP_019155507.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC [Ipomoea nil] Length = 299 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 28/51 (54%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + T+ + P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGSFRILTTKAIEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|XP_010254423.1| PREDICTED: mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Nelumbo nucifera] Length = 173 Score = 38.5 bits (88), Expect(3) = 4e-06 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +3 Query: 123 PCPLYQKALCWSTVGAIRACVGA 191 P PLYQKALC T GAI ACVG+ Sbjct: 57 PLPLYQKALCGLTAGAIGACVGS 79 Score = 30.8 bits (68), Expect(3) = 4e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 77 VGSPADLALIRMQADATL 94 Score = 28.5 bits (62), Expect(3) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 86 LTNKALEANDGKPL 127 LTNKA+ ANDGKPL Sbjct: 45 LTNKAVAANDGKPL 58 >gb|PLY95681.1| hypothetical protein LSAT_2X52420 [Lactuca sativa] Length = 335 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANEGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|XP_023750262.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC [Lactuca sativa] Length = 299 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANEGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >gb|KVH90853.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 290 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANEGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >gb|OTF97701.1| putative mitochondrial 2-oxoglutarate/malate carrier protein [Helianthus annuus] Length = 365 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 141 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 191 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 189 VGSPADLALIRMQADATL 206 >ref|XP_023754871.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Lactuca sativa] gb|PLY92188.1| hypothetical protein LSAT_6X52980 [Lactuca sativa] Length = 299 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|XP_022009344.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Helianthus annuus] Length = 299 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|XP_022026517.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Helianthus annuus] gb|OTG35486.1| putative mitochondrial 2-oxoglutarate/malate carrier protein [Helianthus annuus] Length = 299 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|XP_022001311.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC [Helianthus annuus] gb|OTG01787.1| putative substrate carrier protein [Helianthus annuus] Length = 299 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >gb|KVI08328.1| Mitochondrial carrier domain-containing protein [Cynara cardunculus var. scolymus] Length = 299 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 75 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 125 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 123 VGSPADLALIRMQADATL 140 >ref|NP_197477.1| Mitochondrial substrate carrier family protein [Arabidopsis thaliana] sp|Q9C5M0.1|DTC_ARATH RecName: Full=Mitochondrial dicarboxylate/tricarboxylate transporter DTC; AltName: Full=Dicarboxylate/tricarboxylate carrier gb|AAK25863.1|AF360153_1 putative oxoglutarate/malate translocator protein [Arabidopsis thaliana] gb|AAL07156.1| putative oxoglutarate/malate translocator protein [Arabidopsis thaliana] emb|CAC84549.1| dicarboxylate/tricarboxylate carrier (mitochondrion) [Arabidopsis thaliana] gb|AAM63113.1| oxoglutarate/malate translocator-like protein [Arabidopsis thaliana] dbj|BAE98612.1| oxoglutarate/malate translocator-like protein [Arabidopsis thaliana] gb|AED92746.1| Mitochondrial substrate carrier family protein [Arabidopsis thaliana] gb|OAO93639.1| hypothetical protein AXX17_AT5G19680 [Arabidopsis thaliana] Length = 298 Score = 46.6 bits (109), Expect(2) = 7e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*QTRHLRPMMES---PCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + + + P PLYQKALC T GAI ACVG+ Sbjct: 74 LRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGS 124 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 122 VGSPADLALIRMQADNTL 139 >ref|XP_020877544.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC [Arabidopsis lyrata subsp. lyrata] gb|EFH50221.1| dicarboxylate/tricarboxylate carrier [Arabidopsis lyrata subsp. lyrata] Length = 298 Score = 46.6 bits (109), Expect(2) = 7e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*QTRHLRPMMES---PCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + + + P PLYQKALC T GAI ACVG+ Sbjct: 74 LRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGS 124 Score = 31.2 bits (69), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 122 VGSPADLALIRMQADNTL 139 >ref|NP_001312891.1| mitochondrial dicarboxylate/tricarboxylate transporter DTC-like [Nicotiana tabacum] emb|CAC84545.1| dicarboxylate/tricarboxylate carrier (mitochondrion) [Nicotiana tabacum] Length = 297 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*QT---RHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG ++ + + P PLYQKALC T GAI ACVG+ Sbjct: 73 LRQATYTTARLGSFRSLTNKAIEANEGKPLPLYQKALCGLTAGAIGACVGS 123 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 121 VGSPADLALIRMQADATL 138 >gb|AAU05318.1| putative dicarboxylate/tricarboxylate carrier, partial [Helianthus tuberosus] Length = 223 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/51 (54%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +3 Query: 48 LRQARYTTAILGF*Q---TRHLRPMMESPCPLYQKALCWSTVGAIRACVGA 191 LRQA YTTA LG + + L P PLYQKALC T GAI ACVG+ Sbjct: 16 LRQATYTTARLGTFRILTNKALEANDGKPLPLYQKALCGLTAGAIGACVGS 66 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 190 LGSPADLALIRM*ADRTL 243 +GSPADLALIRM AD TL Sbjct: 64 VGSPADLALIRMQADATL 81