BLASTX nr result
ID: Chrysanthemum22_contig00005748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005748 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022008653.1| ATP-dependent zinc metalloprotease FTSH, chl... 66 2e-19 ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_023887850.1| ATP-dependent zinc metalloprotease FTSH, chl... 66 2e-19 ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 gb|OVA15632.1| Peptidase M41 [Macleaya cordata] 66 2e-19 ref|XP_019255781.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_016514667.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_019187540.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 gb|PNY07350.1| ATP-dependent zinc metalloprotease chloroplastic-... 66 2e-19 ref|XP_019449502.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_016568301.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phas... 66 2e-19 ref|XP_015072970.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 ref|NP_001234196.2| FtsH-like protein precursor [Solanum lycoper... 66 2e-19 ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloproteas... 66 2e-19 dbj|GAU30205.1| hypothetical protein TSUD_311560 [Trifolium subt... 66 2e-19 ref|XP_013462252.1| ATP-dependent zinc metalloprotease FTSH prot... 66 2e-19 >ref|XP_022008653.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic-like [Helianthus annuus] gb|OTF96913.1| putative ATP-dependent zinc metalloprotease FTSH protein [Helianthus annuus] Length = 732 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 459 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 491 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 419 VLAATNRPDVLDSALLRPGRFDRQVTVDR 447 >ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Pyrus x bretschneideri] Length = 721 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 448 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 480 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 408 VLAATNRPDVLDSALLRPGRFDRQVTVDR 436 >ref|XP_023887850.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Quercus suber] gb|POE66912.1| atp-dependent zinc metalloprotease ftsh, chloroplastic [Quercus suber] Length = 719 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 446 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 478 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 406 VLAATNRPDVLDSALLRPGRFDRQVTVDR 434 >ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Malus domestica] Length = 718 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 445 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 477 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 405 VLAATNRPDVLDSALLRPGRFDRQVTVDR 433 >gb|OVA15632.1| Peptidase M41 [Macleaya cordata] Length = 716 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 443 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 475 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 403 VLAATNRPDVLDSALLRPGRFDRQVTVDR 431 >ref|XP_019255781.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Nicotiana attenuata] gb|OIS96961.1| atp-dependent zinc metalloprotease ftsh, chloroplastic [Nicotiana attenuata] Length = 715 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 442 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 474 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 402 VLAATNRPDVLDSALLRPGRFDRQVTVDR 430 >ref|XP_016514667.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like [Nicotiana tabacum] Length = 715 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 442 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 474 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 402 VLAATNRPDVLDSALLRPGRFDRQVTVDR 430 >ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Nicotiana tomentosiformis] Length = 715 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 442 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 474 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 402 VLAATNRPDVLDSALLRPGRFDRQVTVDR 430 >ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Cicer arietinum] Length = 713 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 440 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 472 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 400 VLAATNRPDVLDSALLRPGRFDRQVTVDR 428 >ref|XP_019187540.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Ipomoea nil] Length = 712 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 439 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 471 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 399 VLAATNRPDVLDSALLRPGRFDRQVTVDR 427 >gb|PNY07350.1| ATP-dependent zinc metalloprotease chloroplastic-like [Trifolium pratense] Length = 710 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 437 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 469 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 397 VLAATNRPDVLDSALLRPGRFDRQVTVDR 425 >ref|XP_019449502.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Lupinus angustifolius] gb|OIW07933.1| hypothetical protein TanjilG_20034 [Lupinus angustifolius] Length = 710 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 437 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 469 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 397 VLAATNRPDVLDSALLRPGRFDRQVTVDR 425 >ref|XP_016568301.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Capsicum annuum] gb|PHT51333.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Capsicum baccatum] gb|PHT85030.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Capsicum annuum] gb|PHU21064.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Capsicum chinense] Length = 710 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 437 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 469 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 397 VLAATNRPDVLDSALLRPGRFDRQVTVDR 425 >ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Nicotiana sylvestris] ref|XP_016485203.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Nicotiana tabacum] Length = 710 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 437 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 469 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 397 VLAATNRPDVLDSALLRPGRFDRQVTVDR 425 >ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris] gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris] Length = 709 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 436 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 468 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 396 VLAATNRPDVLDSALLRPGRFDRQVTVDR 424 >ref|XP_015072970.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Solanum pennellii] Length = 708 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 435 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 467 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 395 VLAATNRPDVLDSALLRPGRFDRQVTVDR 423 >ref|NP_001234196.2| FtsH-like protein precursor [Solanum lycopersicum] Length = 708 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 435 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 467 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 395 VLAATNRPDVLDSALLRPGRFDRQVTVDR 423 >ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Solanum tuberosum] Length = 708 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 435 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 467 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 395 VLAATNRPDVLDSALLRPGRFDRQVTVDR 423 >dbj|GAU30205.1| hypothetical protein TSUD_311560 [Trifolium subterraneum] Length = 706 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 433 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 465 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 393 VLAATNRPDVLDSALLRPGRFDRQVTVDR 421 >ref|XP_013462252.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula] Length = 706 Score = 66.2 bits (160), Expect(2) = 2e-19 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +1 Query: 418 VHSRGKALAKDVDFDKIARRTPGFTGAYLQNLM 516 VHSRGKALAKDVDFDKIARRTPGFTGA LQNLM Sbjct: 433 VHSRGKALAKDVDFDKIARRTPGFTGADLQNLM 465 Score = 57.4 bits (137), Expect(2) = 2e-19 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = +2 Query: 332 VLAATNRPDVLGSALLRPGRFDRQVTVDR 418 VLAATNRPDVL SALLRPGRFDRQVTVDR Sbjct: 393 VLAATNRPDVLDSALLRPGRFDRQVTVDR 421