BLASTX nr result
ID: Chrysanthemum22_contig00005565
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00005565 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH95179.1| JmjC domain-containing protein [Cynara cardunculu... 75 3e-12 >gb|KVH95179.1| JmjC domain-containing protein [Cynara cardunculus var. scolymus] Length = 786 Score = 75.1 bits (183), Expect = 3e-12 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 9/61 (14%) Frame = +1 Query: 52 IKYKQMGNEEATSIHGS-------YKLGK--RARERPPLNTCSKRLKVKGPSVTGLEHRY 204 + YK++GN+EA S HG YK GK R RERPPL TC KRLKVKGPS+TGLEHR+ Sbjct: 726 VNYKKLGNKEAVSKHGEHQRDHGFYKQGKGTRERERPPLETCPKRLKVKGPSITGLEHRF 785 Query: 205 L 207 L Sbjct: 786 L 786